Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G10265 59 / 3e-13 Wound-responsive family protein (.1) AT4G10270 57 / 3e-12 Wound-responsive family protein (.1) AT4G05070 40 / 2e-05 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033729 [exp] 67 / 7e-16 AT4G10270 94 / 8e-27 Wound-responsive family protein (.1) Lus10018533 [exp] 61 / 1e-13 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1) Lus10018532 [exp] 61 / 1e-13 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039755 [exp] 59 / 8e-13 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10004297 [exp] 57 / 3e-12 AT4G10265 116 / 1e-35 Wound-responsive family protein (.1) Lus10039761 [exp] 57 / 5e-12 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10039754 [exp] 57 / 5e-12 AT4G10265 116 / 8e-36 Wound-responsive family protein (.1) Lus10018530 [exp] 56 / 1e-11 AT4G10270 119 / 8e-37 Wound-responsive family protein (.1) Lus10039760 [exp] 54 / 4e-11 AT4G10265 120 / 3e-37 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G116800 [exp] 67 / 3e-16 AT4G10270 95 / 3e-27 Wound-responsive family protein (.1) Potri.019G117200 [exp] 66 / 9e-16 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G117201 [exp] 66 / 1e-15 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G116600 [exp] 65 / 2e-15 AT4G10270 82 / 4e-22 Wound-responsive family protein (.1) Potri.019G116866 [exp] 64 / 4e-15 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G116500 [exp] 64 / 5e-15 AT4G10270 107 / 4e-32 Wound-responsive family protein (.1) Potri.019G116932 [exp] 64 / 6e-15 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117100 [exp] 64 / 6e-15 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1) Potri.019G117301 [exp] 64 / 7e-15 AT4G10270 79 / 5e-21 Wound-responsive family protein (.1) Potri.019G117632 [exp] 63 / 1e-14 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10039756 pacid=23165114 polypeptide=Lus10039756 locus=Lus10039756.g ID=Lus10039756.BGIv1.0 annot-version=v1.0 ATGAGTTCGACGAGCAGAGCATGGATGGCGGTTGTGGCTGTGGGAGCAGTGGTGGCACTGAAGGACCAAGGGCTATGCAGATGGAATTATACTTTCAGAT CGATGAACCAGCGTGTTAAGAGTAAGATTAGATCATCGTCAGTTTCCCAATCAAGGCAGATTTCTGCAAGTAGGAAGGTTGCTGTGGAGAACAGGATGAG AGAAACAGAGGAGTCTCTGAAGACTGTAATGTACTTGAGCTGTTGGGGTCCTTACAACTAA
AA sequence Show only first row Show all	>Lus10039756 pacid=23165114 polypeptide=Lus10039756 locus=Lus10039756.g ID=Lus10039756.BGIv1.0 annot-version=v1.0 MSSTSRAWMAVVAVGAVVALKDQGLCRWNYTFRSMNQRVKSKIRSSSVSQSRQISASRKVAVENRMRETEESLKTVMYLSCWGPYN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G10265			Wound-responsive family protei...		Lus10039756 [exp]	0	1
AT4G10250		ATHSP22.0	HSP20-like chaperones superfam...		Lus10040560 [exp]	4.0	0.7110
					Lus10019746 [exp]	18.2	0.6010
AT4G10265			Wound-responsive family protei...		Lus10039761 [exp]	22.7	0.6404
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Lus10002384 [exp]	27.2	0.6001
					Lus10027076 [exp]	29.3	0.6123
AT5G17850			Sodium/calcium exchanger famil...		Lus10034284 [exp]	44.2	0.5966
AT5G57500			Galactosyltransferase family p...		Lus10015527 [exp]	44.7	0.6128
AT1G14590			Nucleotide-diphospho-sugar tra...		Lus10041976 [exp]	56.7	0.5926
AT1G52560			HSP20-like chaperones superfam...		Lus10024225 [exp]	61.0	0.5893
					Lus10029261 [exp]	65.2	0.5842

Compare expression of checked genes

Lus10039756 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.