Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28240 54 / 3e-11 Wound-responsive family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018535 [exp] 120 / 2e-37 AT4G28240 69 / 9e-17 Wound-responsive family protein (.1) Lus10031617 [exp] 102 / 3e-30 AT4G28240 72 / 4e-18 Wound-responsive family protein (.1) Lus10033728 [exp] 84 / 6e-23 AT4G28240 54 / 2e-11 Wound-responsive family protein (.1) Lus10027667 [exp] 58 / 1e-12 ND / Lus10039751 [exp] 39 / 3e-05 AT4G10265 113 / 1e-34 Wound-responsive family protein (.1) Lus10039755 [exp] 36 / 0.0006 AT4G10265 115 / 2e-35 Wound-responsive family protein (.1) Lus10018533 [exp] 36 / 0.0006 AT4G10265 116 / 7e-36 Wound-responsive family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G147700 [exp] 69 / 5e-17 AT4G28240 63 / 1e-14 Wound-responsive family protein (.1) Potri.019G116300 [exp] 53 / 2e-10 AT4G28240 / Wound-responsive family protein (.1) Potri.019G117632 [exp] 40 / 2e-05 AT4G10270 98 / 3e-28 Wound-responsive family protein (.1) Potri.019G117500 [exp] 40 / 2e-05 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.019G117402 [exp] 40 / 2e-05 AT4G10270 97 / 5e-28 Wound-responsive family protein (.1) Potri.011G042000 [exp] 37 / 0.0001 AT4G28240 41 / 3e-06 Wound-responsive family protein (.1) Potri.019G117201 [exp] 37 / 0.0002 AT4G10270 82 / 5e-22 Wound-responsive family protein (.1) Potri.019G117200 [exp] 37 / 0.0002 AT4G10270 79 / 1e-20 Wound-responsive family protein (.1) Potri.019G116866 [exp] 37 / 0.0003 AT4G10270 80 / 3e-21 Wound-responsive family protein (.1) Potri.019G116932 [exp] 36 / 0.0005 AT4G10270 108 / 2e-32 Wound-responsive family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF12609 [flax] [poplar] DUF3774 Wound-induced protein
Representative CDS sequence Show only first row Show all	>Lus10039758 pacid=23165382 polypeptide=Lus10039758 locus=Lus10039758.g ID=Lus10039758.BGIv1.0 annot-version=v1.0 ATGAATCAACTGAACAAATTCTGGACGGCGGCCGCAGTAGCAGTAGCACAGGGGCACCCGACGGAGCAGGGGACTAAGTGGAGATCCTGCTTGCAGTCTC TCAACCACGGCAAGAGGCAAATGTTCTCCAGCGCCGGCGATGGTTCCGATCTCCGGCCTCTTGCTGCTTCGGTCGGATCTGATCGGTCCTCTTCCGTGGG TGATGTAGCGAGGCAGACTGACGAGTCGATGAGACGAGTGATGTACATGAACTGCTGGGGACAGGGGTGA
AA sequence Show only first row Show all	>Lus10039758 pacid=23165382 polypeptide=Lus10039758 locus=Lus10039758.g ID=Lus10039758.BGIv1.0 annot-version=v1.0 MNQLNKFWTAAAVAVAQGHPTEQGTKWRSCLQSLNHGKRQMFSSAGDGSDLRPLAASVGSDRSSSVGDVARQTDESMRRVMYMNCWGQG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28240			Wound-responsive family protei...		Lus10039758 [exp]	0	1
AT4G27130			Translation initiation factor ...		Lus10027181 [exp]	1.4	0.9614
AT3G15290			3-hydroxyacyl-CoA dehydrogenas...		Lus10020828 [exp]	1.4	0.9704
AT5G44250			Protein of unknown function DU...		Lus10042660 [exp]	4.6	0.9602
AT4G32180		ATPANK2	pantothenate kinase 2 (.1.2.3)		Lus10013019 [exp]	6.7	0.9592
AT5G03455		ACR2, ARATH;CDC...	ARSENATE REDUCTASE 2, Rhodanes...		Lus10022616 [exp]	6.7	0.9555
AT5G23050		AAE17	acyl-activating enzyme 17 (.1)		Lus10038966 [exp]	8.1	0.9445
AT1G11530		ATCXXS1	C-terminal cysteine residue is...		Lus10018383 [exp]	8.1	0.9586
AT3G51730			saposin B domain-containing pr...		Lus10025248 [exp]	9.5	0.9583
AT2G01100			unknown protein		Lus10015331 [exp]	12.0	0.9399
AT1G04970			lipid-binding serum glycoprote...		Lus10014625 [exp]	12.6	0.9551

Compare expression of checked genes

Lus10039758 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.