Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018536 [exp] 206 / 1e-70 ND / Lus10033891 [exp] 43 / 9e-07 ND / Lus10003555 [exp] 44 / 1e-06 ND / Lus10024888 [exp] 44 / 2e-06 AT2G36070 445 / 8e-154 translocase inner membrane subunit 44-2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G061780 [exp] 54 / 7e-11 ND / Potri.007G106900 [exp] 53 / 2e-10 ND / Potri.007G117900 [exp] 42 / 3e-06 ND / Potri.007G109600 [exp] 40 / 1e-05 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039759 pacid=23165198 polypeptide=Lus10039759 locus=Lus10039759.g ID=Lus10039759.BGIv1.0 annot-version=v1.0 ATGGCAGATTTCAACAGTAAAGCTGCAATCTTTCTCGCTCTGGTACTGATAATCTCCAACGCCGTCACCTTCTCCGCCGCCATAAACAGCCAGCTTCCAT TTGATGGAGTTGGGTATATGTCACATTTCCAGTGCCGGGAACAGTACACGGCGAAGGACGGCGAGCGGTGCTCCGAGGTAGCTCGGAAGTATAAAATGAG CGATGAGTATTTCAACTTGATCAACCCCAAAGTGAATTGTCCAGGGCTTCTCAAAGGGCAGCTCATCTGCACCAAAGCGTCTGTTAAGGGTTTCAGATGA
AA sequence Show only first row Show all	>Lus10039759 pacid=23165198 polypeptide=Lus10039759 locus=Lus10039759.g ID=Lus10039759.BGIv1.0 annot-version=v1.0 MADFNSKAAIFLALVLIISNAVTFSAAINSQLPFDGVGYMSHFQCREQYTAKDGERCSEVARKYKMSDEYFNLINPKVNCPGLLKGQLICTKASVKGFR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039759 [exp]	0	1
					Lus10040066 [exp]	1.0	0.9687
AT3G12660		FLA14	FASCICLIN-like arabinogalactan...		Lus10026107 [exp]	1.7	0.9374
AT2G42280	bHLH	bHLH130	basic helix-loop-helix (bHLH) ...		Lus10037484 [exp]	2.0	0.9242
AT3G02750			Protein phosphatase 2C family ...		Lus10022683 [exp]	4.0	0.9422
AT5G60900		RLK1	receptor-like protein kinase 1...		Lus10000422 [exp]	4.6	0.9056
AT1G79860		ATROPGEF12, ROP...	MATERNAL EFFECT EMBRYO ARREST ...		Lus10035865 [exp]	6.9	0.8789
AT2G28305		ATLOG1	LONELY GUY 1, Putative lysine ...		Lus10021462 [exp]	6.9	0.9003
AT1G01120		KCS1	3-ketoacyl-CoA synthase 1 (.1)		Lus10000101 [exp]	7.8	0.8689
AT4G18380			F-box family protein (.1.2)		Lus10013431 [exp]	8.2	0.8874
AT3G61220		SDR1	short-chain dehydrogenase/redu...		Lus10009824 [exp]	9.6	0.9037

Compare expression of checked genes

Lus10039759 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.