Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G17140 68 / 2e-14 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011036 [exp] 86 / 6e-21 AT4G17140 3546 / 0.0 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3) Lus10003007 [exp] 86 / 7e-21 AT4G17140 3544 / 0.0 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3) Lus10006816 [exp] 76 / 7e-18 AT4G17140 59 / 8e-10 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3) Lus10003381 [exp] 74 / 4e-17 AT4G17140 52 / 3e-07 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G148800 [exp] 65 / 2e-13 AT4G17140 3708 / 0.0 pleckstrin homology (PH) domain-containing protein (.1), pleckstrin homology (PH) domain-containing protein (.2), pleckstrin homology (PH) domain-containing protein (.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039773 pacid=23165334 polypeptide=Lus10039773 locus=Lus10039773.g ID=Lus10039773.BGIv1.0 annot-version=v1.0 ATGCAAGTCTGGGAAATATACTCAGACCAGAATTCCCTTATTGTTTACTACTTCCACTTATGTCGCGAAGGTCATGGTCAATCATCGCCTCATGGTCTCA TTGCTAAGAGTGCAACTGCTTTTGACTCTTCATTTGGCATGTTCTGCTACAAGCCTTTTGGCGTGAAGGTGGATTGGAGCTTGGCTGCGAAGGCTTCTCC GAGTTACATGACTCTATGTTTGCCTCTTCATTTCTTTACTTCTTCCTGTGTCTTCTCCTATCACCACTCTTGCTGGAACTTCATCTCATCCAAGGGACTC CGAAACTGA
AA sequence Show only first row Show all	>Lus10039773 pacid=23165334 polypeptide=Lus10039773 locus=Lus10039773.g ID=Lus10039773.BGIv1.0 annot-version=v1.0 MQVWEIYSDQNSLIVYYFHLCREGHGQSSPHGLIAKSATAFDSSFGMFCYKPFGVKVDWSLAAKASPSYMTLCLPLHFFTSSCVFSYHHSCWNFISSKGL RN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G17140			pleckstrin homology (PH) domai...		Lus10039773 [exp]	0	1
					Lus10025147 [exp]	12.5	0.6301
AT5G04895			DEA(D/H)-box RNA helicase fami...		Lus10034126 [exp]	14.9	0.7199
AT2G18850			SET domain-containing protein ...		Lus10025463 [exp]	29.4	0.6144
AT2G26270			unknown protein		Lus10009795 [exp]	31.9	0.6486
AT5G14210			Leucine-rich repeat protein ki...		Lus10041589 [exp]	73.7	0.5541
AT2G03880		REME1	required for efficiency of mit...		Lus10022974 [exp]	75.3	0.6108
AT3G63090			Ubiquitin carboxyl-terminal hy...		Lus10028011 [exp]	84.0	0.5789
AT1G22460			O-fucosyltransferase family pr...		Lus10020943 [exp]	91.1	0.5817
AT3G09430			unknown protein		Lus10023771 [exp]	108.8	0.5420
AT3G61415		ASK21	SKP1-like 21 (.1.2)		Lus10018833 [exp]	118.4	0.5533

Compare expression of checked genes

Lus10039773 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.