Lus10039781 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018552 259 / 1e-88 ND /
Lus10039778 112 / 6e-31 ND /
Lus10018550 111 / 2e-30 ND /
Lus10039776 99 / 1e-25 ND /
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G108500 62 / 5e-12 ND /
Potri.019G108700 55 / 2e-09 ND /
PFAM info
Representative CDS sequence
>Lus10039781 pacid=23165319 polypeptide=Lus10039781 locus=Lus10039781.g ID=Lus10039781.BGIv1.0 annot-version=v1.0
ATGGACAGAAGAACCAAAATACACAAATCCTCCTCCGCCGCCGACCTGACGCCGGCCAACCGCAACTCCTTCGCCGACTACGCCCTCGCCAAATCAACAG
CAGCCCACCTTCAAACATTCCCTGCTCCGGTAGACGACCTACCCGACATCGACGGCGAACCCAATTTCTTCCTCCCATCCAGTTCCACAGCTCCTCTGCC
TCCGCCAATTACAAAGCCAAAAGCTCCATGCTTTTCATCGGATTCGAGGCGTCTGGATCTAACCGCTGCAAGGAGGAAGTACGATGAGAACAGCGGAAAC
AGCAGAACAGAGTCCCAGAAGGCAGAGCTGAAACGCGCCGTTTTGAGACGATTGAAGGAGTTGTCAGAGATGGAAGCGAACAGCAAAGTCGCCATCGAGA
TCGCCGAAGCCGCCGATTTCCTGAAGGCTCTGTACGGCTCCGATTCGGCTCTGATTGAAATAAGCGAGAATAGCCGGGAAGGAGTCATGCGGTTGCAGGA
AGGTCAGCTGCTTGTTAAGAAATCGCAGGACCAGCTGCGATCTCTACTTCGCCATAAGCTTTTCTCCCTTGATTAA
AA sequence
>Lus10039781 pacid=23165319 polypeptide=Lus10039781 locus=Lus10039781.g ID=Lus10039781.BGIv1.0 annot-version=v1.0
MDRRTKIHKSSSAADLTPANRNSFADYALAKSTAAHLQTFPAPVDDLPDIDGEPNFFLPSSSTAPLPPPITKPKAPCFSSDSRRLDLTAARRKYDENSGN
SRTESQKAELKRAVLRRLKELSEMEANSKVAIEIAEAADFLKALYGSDSALIEISENSREGVMRLQEGQLLVKKSQDQLRSLLRHKLFSLD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039781 0 1
AT5G26250 Major facilitator superfamily ... Lus10041212 3.0 0.9079
AT5G18310 unknown protein Lus10042520 3.3 0.8879
AT1G07160 Protein phosphatase 2C family ... Lus10026381 4.6 0.9141
AT3G61180 RING/U-box superfamily protein... Lus10012427 6.9 0.8830
AT3G20600 NDR1 non race-specific disease resi... Lus10043067 8.4 0.8979
AT5G38700 unknown protein Lus10002433 9.1 0.9130
Lus10029449 10.4 0.8670
AT2G24240 BTB/POZ domain with WD40/YVTN ... Lus10021855 10.9 0.8418
AT1G17420 ATLOX3, LOX3 Arabidopsis thaliana lipoxygen... Lus10008113 12.0 0.9050
AT1G72470 ATEXO70D1 exocyst subunit exo70 family p... Lus10008126 12.1 0.8719

Lus10039781 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.