Lus10039783 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G03320 262 / 3e-87 AtTic20-IV, TIC20-IV translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
AT1G04940 172 / 2e-52 AtTic20-I, atTIC20, TIC20 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
AT1G04945 158 / 7e-44 HIT-type Zinc finger family protein (.1.2.3)
AT2G47840 41 / 0.0005 AtTic20-II translocon at the inner envelope membrane of chloroplasts 20-II, Uncharacterised conserved protein ycf60 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010636 156 / 4e-46 AT1G04940 338 / 9e-118 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Lus10033195 153 / 4e-45 AT1G04940 341 / 7e-119 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G108800 301 / 2e-102 AT4G03320 283 / 2e-95 translocon at the inner envelope membrane of chloroplasts 20-IV (.1)
Potri.002G031800 171 / 5e-52 AT1G04940 363 / 1e-127 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
Potri.005G231400 168 / 1e-50 AT1G04940 360 / 2e-126 translocon at the inner envelope membrane of chloroplasts 20-I, translocon at the inner envelope membrane of chloroplasts 20 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF09685 DUF4870 Domain of unknown function (DUF4870)
Representative CDS sequence
>Lus10039783 pacid=23165272 polypeptide=Lus10039783 locus=Lus10039783.g ID=Lus10039783.BGIv1.0 annot-version=v1.0
ATGCTGCTTTACTGTAATATATCTGTGATTTCTCTTCGCAATTTGATTCGGGAAATTCACTGTAAATTGATCAGGTATAGGGATACGATCACAAGAAGAG
GAATACACGACTCTTTGAATGGAAAATCCAGCATCGTGTGCCAGTCTAACTTTGCTGGATTGCCTAGCTTGTCATTAACGTCAAACGGAACCAATAAGCT
TCAACATGTAACCACTTTTAAAGATAAGTCACTTTGGGACCTCTTCTCTACACCAGTCTCACGTTTCGGAGATCAAGATAGCGGGTCATCAAACAAGCTT
CCCAAGCTACCCAGAAGACGTTCCTTAAAACCCACAGCGGCATACAAGAACTTCAACCACCCAGTCTTCGCCGAGAAGCCAGAGTGGTGGTGGAGGACCT
TAGCATGCGTCCCTTACTTGATCGCCTTACAAATATCAGACGCAGGGTTCTACATCCAGCCCTTGGTAGAACACTACCGGTCCCTCGAGAACATAATCTA
CTTCATCCCGGGAGCCATCACGAGGTTACCGCCCTGGTTCACGATGATCTACTGCTACTTCGCCTACCTCGGGGTGGTGAAGAATAAAGAGTGGCCTCAC
TTCATCAGGTTCCATCTCATGATGGGGATGCTGCTGGAGACTTCTCTGCAGATTGTTTGGTGGACGAGTAACTTCTTCCCTCTCATTCACTACAACGGCA
AGTTCGGTATGTACTATTGGGCCGGGATCGGGTTTGCGTACATGTTGATCTTGCTGCAGTGTGTTCGAGGCGCTCTTGCTGGTGGGTATGCTTATATTCC
GTTCATCTCTGAGAATGCTGAAATTCATACCAAGTTCAGTATCGGAGGGTTCCAAAGGCCTTGGTGA
AA sequence
>Lus10039783 pacid=23165272 polypeptide=Lus10039783 locus=Lus10039783.g ID=Lus10039783.BGIv1.0 annot-version=v1.0
MLLYCNISVISLRNLIREIHCKLIRYRDTITRRGIHDSLNGKSSIVCQSNFAGLPSLSLTSNGTNKLQHVTTFKDKSLWDLFSTPVSRFGDQDSGSSNKL
PKLPRRRSLKPTAAYKNFNHPVFAEKPEWWWRTLACVPYLIALQISDAGFYIQPLVEHYRSLENIIYFIPGAITRLPPWFTMIYCYFAYLGVVKNKEWPH
FIRFHLMMGMLLETSLQIVWWTSNFFPLIHYNGKFGMYYWAGIGFAYMLILLQCVRGALAGGYAYIPFISENAEIHTKFSIGGFQRPW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G03320 AtTic20-IV, TIC... translocon at the inner envelo... Lus10039783 0 1
AT4G35630 PSAT phosphoserine aminotransferase... Lus10039587 2.0 0.9165
AT5G16990 Zinc-binding dehydrogenase fam... Lus10010988 3.7 0.9143
AT5G58730 pfkB-like carbohydrate kinase ... Lus10018235 3.9 0.9159
AT3G55370 DOF OBP3, AtDof3. 6 OBF-binding protein 3 (.1.2.3) Lus10036172 4.2 0.9145
AT2G31390 STH pfkB-like carbohydrate kinase ... Lus10009526 5.7 0.9160
AT3G55730 MYB ATMYB109 myb domain protein 109 (.1) Lus10040239 6.6 0.8953
AT5G56350 Pyruvate kinase family protein... Lus10013396 9.7 0.8974
AT5G13420 Aldolase-type TIM barrel famil... Lus10032613 12.8 0.9073
AT1G77670 Pyridoxal phosphate (PLP)-depe... Lus10014710 12.8 0.8880
AT4G29120 6-phosphogluconate dehydrogena... Lus10034977 15.2 0.8891

Lus10039783 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.