Plant FIBer expression Database

Lus10039788 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20830 132 / 1e-37 transferases;folic acid binding (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018557
[exp]
263 / 4e-92 AT2G20830 125 / 4e-35 transferases;folic acid binding (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.013G145800
[exp]
221 / 7e-76 AT2G20830 137 / 2e-39 transferases;folic acid binding (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0255 ATP_synthase PF09811 Yae1_N Essential protein Yae1, N terminal
Representative CDS sequence
>Lus10039788 pacid=23165001 polypeptide=Lus10039788 locus=Lus10039788.g ID=Lus10039788.BGIv1.0 annot-version=v1.0
ATGGATAACGGAGACATATTTGAATCCTCATTGAATCTGGAGGAGACGCATTACAGAGAAGGGTACGATGAAGGACACAGTGATGGCCTAGTTGCTGGCA
AAGACGAGGCCAAACAAGTTGGCTTGAAAACGGGGTTCGAAACCGGGGAGGAACTCGGGTTCTACCGCGGTTGCATCGACCTGTGGAACTCGGCAATCCT
GGTTTCCCCGACACATTTCTCGTCCCGAATCCAGAAGACTGTAAAGCAAATGGAGCAACTCATTAACCAATACCCGCTTCTGGATCCCGAGGATGAGAGA
GTTCAGGCGATGATGGATAGTCTAAGGTTGAAGTTCCGGGTCATAAGAGCCGGTCTCGGTGTGAAGTTGGAGTATGATGGATATCCAAAGCCTCAAGAAA
TGGAGTTTTGA
AA sequence
>Lus10039788 pacid=23165001 polypeptide=Lus10039788 locus=Lus10039788.g ID=Lus10039788.BGIv1.0 annot-version=v1.0
MDNGDIFESSLNLEETHYREGYDEGHSDGLVAGKDEAKQVGLKTGFETGEELGFYRGCIDLWNSAILVSPTHFSSRIQKTVKQMEQLINQYPLLDPEDER
VQAMMDSLRLKFRVIRAGLGVKLEYDGYPKPQEMEF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20830 transferases;folic acid bindin... Lus10039788
[exp]
0 1
AT1G76890 Trihelix AT-GT2, GT2 Duplicated homeodomain-like su... Lus10020873
[exp]
3.3 0.8127
AT2G46150 Late embryogenesis abundant (L... Lus10036403
[exp]
10.2 0.7935
AT3G60580 C2H2ZnF C2H2-like zinc finger protein ... Lus10004724
[exp]
10.6 0.8071
AT4G01200 Calcium-dependent lipid-bindin... Lus10008731
[exp]
15.0 0.7881
AT2G23780 RING/U-box superfamily protein... Lus10016796
[exp]
17.9 0.8011
AT5G58070 ATTIL temperature-induced lipocalin ... Lus10036298
[exp]
21.5 0.7882
AT3G03980 NAD(P)-binding Rossmann-fold s... Lus10002628
[exp]
21.8 0.7844
AT4G24060 DOF AtDof4,6 Dof-type zinc finger DNA-bindi... Lus10003208
[exp]
22.4 0.7860
AT3G08690 ATUBC11, UBC11 ubiquitin-conjugating enzyme 1... Lus10007126
[exp]
24.3 0.7910
AT1G28220 ATPUP3 purine permease 3 (.1) Lus10036465
[exp]
25.9 0.7830

Lus10039788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.