Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20835 89 / 3e-25 unknown protein AT3G15534 82 / 2e-22 unknown protein AT1G52855 80 / 7e-22 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018561 [exp] 102 / 2e-30 AT2G20835 111 / 2e-34 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G405400 [exp] 89 / 2e-25 AT1G52855 85 / 9e-24 unknown protein Potri.019G104300 [exp] 85 / 1e-23 AT1G52855 116 / 2e-36 unknown protein Potri.019G104100 [exp] 85 / 1e-23 AT1G52855 116 / 2e-36 unknown protein Potri.011G124800 [exp] 84 / 2e-23 AT1G52855 119 / 1e-37 unknown protein Potri.013G145100 [exp] 84 / 3e-23 AT1G52855 112 / 2e-34 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039793 pacid=23165145 polypeptide=Lus10039793 locus=Lus10039793.g ID=Lus10039793.BGIv1.0 annot-version=v1.0 ATGGCGGTGTTCTGTTTTCTGGTGGATCAGAGGCAGAAGATGAGGAGCAGCAAGCCGGCGGCGGGATCCTGCTCGAGGTGTGGCGGCGGAGCTAGCATCG CCGACATGAGGACCAGCACCAGGTTCTGCTACGTCCCCTTCTACCGAAAGTCATGGCGGGCCATCGTCTGCACCTTCTGCGGCGCCGTTCTCCGTTCTTA CCGATGA
AA sequence Show only first row Show all	>Lus10039793 pacid=23165145 polypeptide=Lus10039793 locus=Lus10039793.g ID=Lus10039793.BGIv1.0 annot-version=v1.0 MAVFCFLVDQRQKMRSSKPAAGSCSRCGGGASIADMRTSTRFCYVPFYRKSWRAIVCTFCGAVLRSYR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20835			unknown protein		Lus10039793 [exp]	0	1
AT2G20835			unknown protein		Lus10018561 [exp]	1.4	0.9133
AT1G33100			MATE efflux family protein (.1...		Lus10005685 [exp]	8.9	0.8595
AT4G18770	MYB	ATMYB98	myb domain protein 98 (.1)		Lus10042111 [exp]	10.1	0.8828
AT3G24420			alpha/beta-Hydrolases superfam...		Lus10017735 [exp]	10.5	0.8839
AT4G16740		ATTPS03	terpene synthase 03 (.1.2)		Lus10039713 [exp]	21.4	0.8527
AT1G17960			Threonyl-tRNA synthetase (.1)		Lus10030644 [exp]	21.4	0.8604
AT3G18430			Calcium-binding EF-hand family...		Lus10029670 [exp]	22.0	0.8481
AT2G37540			NAD(P)-binding Rossmann-fold s...		Lus10023762 [exp]	29.1	0.8591
					Lus10020641 [exp]	30.6	0.8464
AT5G25610		ATRD22, RD22	RESPONSIVE TO DESSICATION 22, ...		Lus10022114 [exp]	31.1	0.8514

Compare expression of checked genes

Lus10039793 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.