Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20870 39 / 9e-05 cell wall protein precursor, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018569 [exp] 143 / 5e-46 AT2G20870 39 / 6e-05 cell wall protein precursor, putative (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G144200 [exp] 42 / 3e-06 AT2G20870 42 / 1e-05 cell wall protein precursor, putative (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039801 pacid=23165210 polypeptide=Lus10039801 locus=Lus10039801.g ID=Lus10039801.BGIv1.0 annot-version=v1.0 ATGGCTACCATGCATTCAAAAGCTTCTCTGTTGGCTCTCCTCATACTGCTCACTGTATCCAGTAGTCAAGTCCTCGCAGGGCGTCATACCCCCAGCAAGA ACGAGGTCCTCGAACCAGAGAACTTAACCATCGGAGGGGTTCGTATCCCTCAATTCCGCATCCCTTCTTTCACCCCCTATACCGGTAATGGCAGATACAT TCCAGGGAACGATGACACATTTGTTCCTAACCCTGGTTATGAAGTCCCGAATCCTAACTACAAGGGTGGTAGTGGCAATCCTTGA
AA sequence Show only first row Show all	>Lus10039801 pacid=23165210 polypeptide=Lus10039801 locus=Lus10039801.g ID=Lus10039801.BGIv1.0 annot-version=v1.0 MATMHSKASLLALLILLTVSSSQVLAGRHTPSKNEVLEPENLTIGGVRIPQFRIPSFTPYTGNGRYIPGNDDTFVPNPGYEVPNPNYKGGSGNP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20870			cell wall protein precursor, p...		Lus10039801 [exp]	0	1
AT3G55150		ATEXO70H1	exocyst subunit exo70 family p...		Lus10023455 [exp]	1.0	0.9669
AT2G20870			cell wall protein precursor, p...		Lus10018569 [exp]	1.4	0.9556
AT1G15360	AP2_ERF	WIN1, SHN1	WAX INDUCER 1, SHINE 1, Integr...		Lus10002015 [exp]	2.4	0.9379
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10035903 [exp]	2.8	0.9223
AT3G61430		ATPIP1, PIP1;1,...	PLASMA MEMBRANE INTRINSIC PROT...		Lus10042385 [exp]	6.5	0.8971
AT1G69850		NTL1, ATNRT1:2	nitrate transporter 1:2 (.1)		Lus10005417 [exp]	7.5	0.8919
AT1G63710		CYP86A7	"cytochrome P450, family 86, s...		Lus10024644 [exp]	8.1	0.9058
AT3G07870			F-box and associated interacti...		Lus10036105 [exp]	8.2	0.8477
AT1G69850		NTL1, ATNRT1:2	nitrate transporter 1:2 (.1)		Lus10015240 [exp]	9.5	0.8716
AT1G11600		CYP77B1	"cytochrome P450, family 77, s...		Lus10018350 [exp]	10.4	0.8875

Compare expression of checked genes

Lus10039801 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.