Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018576 [exp] 74 / 2e-18 AT2G20875 120 / 2e-36 epidermal patterning factor 1 (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039807 pacid=23165176 polypeptide=Lus10039807 locus=Lus10039807.g ID=Lus10039807.BGIv1.0 annot-version=v1.0 ATGGTTCGCCGTCTCTCAAAAAAACCACAACCGCCATCATTCGATAAGAGAAGGGAGCAAGGTGGAGGAGACAATTATGAGATACTACAGGAGACCGGTT TGAGGAGGAAGGTCGAAGAAGAACAATGGCGGGCCGGACACGGTCCAAATAGCGGGTTCGAGCTTGCCCGACTGCTCCCACGCGTGCGGGTCGTGCTCGC CGTGTAG
AA sequence Show only first row Show all	>Lus10039807 pacid=23165176 polypeptide=Lus10039807 locus=Lus10039807.g ID=Lus10039807.BGIv1.0 annot-version=v1.0 MVRRLSKKPQPPSFDKRREQGGGDNYEILQETGLRRKVEEEQWRAGHGPNSGFELARLLPRVRVVLAV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039807 [exp]	0	1
AT4G24270		EMB140	EMBRYO DEFECTIVE 140 (.1.2)		Lus10016122 [exp]	1.0	0.9013
AT5G44785		OSB3	organellar single-stranded DNA...		Lus10002722 [exp]	4.0	0.8426
AT2G02450	NAC	LOV1, ANAC034, ...	LONG VEGETATIVE PHASE 1, Arabi...		Lus10003367 [exp]	5.0	0.8400
AT4G26150	GATA	GATA22, CGA1, G...	GNC-LIKE, GATA TRANSCRIPTION F...		Lus10006000 [exp]	8.8	0.8606
AT2G47460	MYB	PFG1, ATMYB12	PRODUCTION OF FLAVONOL GLYCOSI...		Lus10010273 [exp]	10.6	0.8184
AT1G53140		DRP5A	Dynamin related protein 5A (.1...		Lus10008749 [exp]	11.4	0.7974
AT1G69710			Regulator of chromosome conden...		Lus10037192 [exp]	12.0	0.8447
AT2G02070	C2H2ZnF	ATIDD5	indeterminate(ID)-domain 5 (.1...		Lus10035092 [exp]	12.5	0.7377
AT2G02800		Kin2, APK2B	protein kinase 2B (.1.2)		Lus10042192 [exp]	13.9	0.8072
AT2G40475		ASG8	ALTERED SEED GERMINATION 8, un...		Lus10012896 [exp]	14.3	0.7957

Compare expression of checked genes

Lus10039807 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.