Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28290 49 / 1e-09 unknown protein AT5G42110 44 / 1e-07 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018592 [exp] 70 / 1e-17 AT4G28290 52 / 1e-10 unknown protein Lus10031644 [exp] 59 / 2e-13 AT4G28290 59 / 2e-13 unknown protein Lus10033693 [exp] 57 / 1e-12 AT4G28290 62 / 3e-14 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G100601 [exp] 52 / 1e-10 AT4G28290 49 / 3e-09 unknown protein Potri.019G111501 [exp] 51 / 2e-10 AT4G28290 49 / 3e-09 unknown protein Potri.001G449633 [exp] 49 / 1e-09 AT4G28290 45 / 7e-08 unknown protein Potri.013G131900 [exp] 49 / 2e-09 AT4G28290 47 / 7e-09 unknown protein Potri.011G151900 [exp] 42 / 7e-07 AT5G42110 38 / 3e-05 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039825 pacid=23165354 polypeptide=Lus10039825 locus=Lus10039825.g ID=Lus10039825.BGIv1.0 annot-version=v1.0 ATGAAAACATCAAGCTTTCTCGCCGCCGTCGCCGCCGCAGCGGCGTCTGCAACCGCCATCTCCGTTTCTTCTTCATCATCATCATATCTCCAGGAGGGTG GTTTGAGCAACGATCAGAAGCAGATCAGGCCGGCGACGACACCGGAGAAGTTTGCGCCGAGGTTCGACGGGCTTAGGTTTATCGAGACGTTGGTGACAGC TCATCGGTGA
AA sequence Show only first row Show all	>Lus10039825 pacid=23165354 polypeptide=Lus10039825 locus=Lus10039825.g ID=Lus10039825.BGIv1.0 annot-version=v1.0 MKTSSFLAAVAAAAASATAISVSSSSSSYLQEGGLSNDQKQIRPATTPEKFAPRFDGLRFIETLVTAHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28290			unknown protein		Lus10039825 [exp]	0	1
AT4G29890			choline monooxygenase, putativ...		Lus10008571 [exp]	2.8	0.9440
AT3G07370		ATCHIP, CHIP	carboxyl terminus of HSC70-int...		Lus10038219 [exp]	2.8	0.9477
AT5G64370		PYD3, BETA-UP	PYRIMIDINE 3, beta-ureidopropi...		Lus10020436 [exp]	3.2	0.9481
AT2G39920			HAD superfamily, subfamily III...		Lus10028259 [exp]	6.7	0.9464
AT4G29890			choline monooxygenase, putativ...		Lus10032689 [exp]	18.0	0.9363
AT1G44770			unknown protein		Lus10034500 [exp]	19.3	0.9399
AT5G41210		GSTU12, GST10, ...	glutathione S-transferase THET...		Lus10008021 [exp]	23.2	0.9344
AT1G44770			unknown protein		Lus10014131 [exp]	23.6	0.9415
AT2G23450			Protein kinase superfamily pro...		Lus10011652 [exp]	24.2	0.9427
AT3G44710			Plant protein of unknown funct...		Lus10020562 [exp]	24.3	0.9391

Compare expression of checked genes

Lus10039825 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.