Lus10039849 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G02550 44 / 2e-05 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
AT2G47340 40 / 0.0004 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018615 217 / 9e-73 AT1G02550 49 / 3e-07 Plant invertase/pectin methylesterase inhibitor superfamily protein (.1)
Lus10018614 57 / 7e-11 AT1G22630 135 / 9e-43 unknown protein
Poplar homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF04043 PMEI Plant invertase/pectin methylesterase inhibitor
Representative CDS sequence
>Lus10039849 pacid=23165315 polypeptide=Lus10039849 locus=Lus10039849.g ID=Lus10039849.BGIv1.0 annot-version=v1.0
ATGATTTCCATTTCAGCAGCATTATCAGGGTTCGTCCTCACTGGAGATCAAGTAAAGTATAAACCATCAAGAACTGTTCAAGTAAAGGTTTCTGCAGCCA
AATCTGGAGGATTCTCTTTCAACTCTTCGCAATCTCCTTCCGTCGGCGCCGGTGGCACGTACCAGGACCCCGTCTCGATCCTCAACCTCGAGATCGAGCT
CCTCTACAAGAAGGTGGAGAAGGCCGCCGACGAGGCGGATGAGATCGGGAAAAAGGGTTCCACCCCTGCTGACGTGGCAAAGGCGCTGACGGCTTGCGTG
GAGGATTACAACAAGGCGAAGGATGACCTGGCGCAGGCTCTGTTGCAGTTTTCCGAGAAGAAGGACGCTGCCGCCGTGGATGGGAGTCTGATGTCGGCTG
CCACGTGGATCAAGAAATGCGACGGTGGGTTTGCTGCCGGGAAGGAGAAGGAGGAGGAGGAGAAGAGTTCGTCGACGGCGCCGTTGAAGAAGATTAATGT
GAAGATGGTTGAGATGGCGGAGTTGGGGATTGAGATCTCCGATAAGTGGCTTAAGAAAGCTAATTAA
AA sequence
>Lus10039849 pacid=23165315 polypeptide=Lus10039849 locus=Lus10039849.g ID=Lus10039849.BGIv1.0 annot-version=v1.0
MISISAALSGFVLTGDQVKYKPSRTVQVKVSAAKSGGFSFNSSQSPSVGAGGTYQDPVSILNLEIELLYKKVEKAADEADEIGKKGSTPADVAKALTACV
EDYNKAKDDLAQALLQFSEKKDAAAVDGSLMSAATWIKKCDGGFAAGKEKEEEEKSSSTAPLKKINVKMVEMAELGIEISDKWLKKAN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G02550 Plant invertase/pectin methyle... Lus10039849 0 1
AT1G25480 Aluminium activated malate tra... Lus10021694 1.0 0.9121
Lus10024445 6.9 0.8878
AT5G17680 disease resistance protein (TI... Lus10010221 7.3 0.8950
AT5G19450 CPK8, CDPK19 calcium-dependent protein kina... Lus10030134 7.6 0.9025
AT5G39670 Calcium-binding EF-hand family... Lus10026301 9.5 0.8623
AT2G17080 Arabidopsis protein of unknown... Lus10012368 15.5 0.8588
AT1G25480 Aluminium activated malate tra... Lus10035037 15.7 0.8386
AT3G15200 Tetratricopeptide repeat (TPR)... Lus10031270 16.6 0.8653
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10006084 17.9 0.8846
AT4G10790 UBX domain-containing protein ... Lus10039951 21.9 0.8754

Lus10039849 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.