Lus10039851 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018616 114 / 4e-30 AT5G36930 578 / 0.0 Disease resistance protein (TIR-NBS-LRR class) family (.1), Disease resistance protein (TIR-NBS-LRR class) family (.2)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039851 pacid=23165237 polypeptide=Lus10039851 locus=Lus10039851.g ID=Lus10039851.BGIv1.0 annot-version=v1.0
ATGCATCGTAGGAGGTTTTCGCAGTCCCGGCCACGGTGCTTGACGATCGGGAGCTCGAAGAAGATGAGAGGGGAAATGTTCTACGGTGGGCCACATCAAG
AAGATGAGCTATATTCTAAGTGGTCAGAGCTAAGGTCGAAAAGACTGAAGGAGGCCACTAACTTTCTGTCTGCAAATGGAGAAGAGGAGGAATCAGACGA
GGATGTCGACGCTGATGGTTCGAGATTGGAAGACGACATGGAATGGCTTGATTACTGCGATGATGACGACGCTGATGGTTCGAGATTGGAAGACGACATG
GAATGGCTTGATTACTGCGATGATGACGACGATGAAGAAGAAGGAGATAAGAGTGAGCTTTATGAGGTTTCTGAAGAGGAAGGAGATGAAGAAACAGACT
AG
AA sequence
>Lus10039851 pacid=23165237 polypeptide=Lus10039851 locus=Lus10039851.g ID=Lus10039851.BGIv1.0 annot-version=v1.0
MHRRRFSQSRPRCLTIGSSKKMRGEMFYGGPHQEDELYSKWSELRSKRLKEATNFLSANGEEEESDEDVDADGSRLEDDMEWLDYCDDDDADGSRLEDDM
EWLDYCDDDDDEEEGDKSELYEVSEEEGDEETD

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039851 0 1
AT3G02130 TOAD2, RPK2, CL... TOADSTOOL 2, clv3 peptide inse... Lus10036899 1.0 0.8189
AT4G32285 ENTH/ANTH/VHS superfamily prot... Lus10043260 6.5 0.7967
AT2G25430 epsin N-terminal homology (ENT... Lus10019402 9.9 0.7991
AT2G40300 ATFER4 ferritin 4 (.1) Lus10007523 11.3 0.7605
AT3G46790 CRR2 CHLORORESPIRATORY REDUCTION 2,... Lus10001558 14.4 0.7569
AT1G32640 bHLH JIN1, JAI1, ZBF... JASMONATE INSENSITIVE 1, Basic... Lus10030970 17.0 0.7513
AT1G33560 ADR1 ACTIVATED DISEASE RESISTANCE 1... Lus10032759 22.8 0.7446
AT4G03400 GH3-10, DFL2 DWARF IN LIGHT 2, Auxin-respon... Lus10018565 25.3 0.7542
AT1G28150 unknown protein Lus10030561 40.3 0.7313
AT1G31790 Tetratricopeptide repeat (TPR)... Lus10035697 43.1 0.7117

Lus10039851 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.