Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010798 [exp] 112 / 9e-31 AT5G27260 61 / 5e-10 unknown protein Lus10018622 [exp] 100 / 4e-29 ND / Lus10039857 [exp] 37 / 0.0006 AT5G44210 138 / 8e-41 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G138100 [exp] 77 / 6e-19 AT5G44210 149 / 3e-45 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1) Potri.017G013700 [exp] 52 / 2e-09 AT5G44210 103 / 2e-27 ERF DOMAIN PROTEIN- 9, erf domain protein 9 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039856 pacid=23165374 polypeptide=Lus10039856 locus=Lus10039856.g ID=Lus10039856.BGIv1.0 annot-version=v1.0 ATGGTTGGTAGGTTCCCGTTTGTGTACCAACAGCAGCAGCAGGGGGTGGTGACTCCGGTGTGGTTCTTCGACGGGATGGTGAAGCCGGAGTTTTTGACAG CCCAACGGTTTCCAGTCCGGTTCGACCCGGTGGATTACAACGGCGGAAGAGCTCATAGCGAAACGGATTCGACATCATCGGTGGTTTTAGATTGCAAGCC GAGCAGCAATGGAGGAAGCGGAGGAGTTCTGTATCGGGATCTCAACCCCGCCCCGCCGGCAGAGGCTTGA
AA sequence Show only first row Show all	>Lus10039856 pacid=23165374 polypeptide=Lus10039856 locus=Lus10039856.g ID=Lus10039856.BGIv1.0 annot-version=v1.0 MVGRFPFVYQQQQQGVVTPVWFFDGMVKPEFLTAQRFPVRFDPVDYNGGRAHSETDSTSSVVLDCKPSSNGGSGGVLYRDLNPAPPAEA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039856 [exp]	0	1
					Lus10018622 [exp]	1.4	0.9082
AT1G29340		ATPUB17, PUB17	ARABIDOPSIS THALIANA PLANT U-B...		Lus10029267 [exp]	3.5	0.8370
AT5G59030		COPT1	copper transporter 1 (.1)		Lus10016464 [exp]	4.0	0.8342
AT3G16190			Isochorismatase family protein...		Lus10006833 [exp]	12.0	0.8139
AT4G30440		GAE1	UDP-D-glucuronate 4-epimerase ...		Lus10023213 [exp]	13.9	0.8352
AT1G73500		ATMKK9	MAP kinase kinase 9 (.1)		Lus10040127 [exp]	14.4	0.8200
AT1G07710			Ankyrin repeat family protein ...		Lus10024440 [exp]	14.5	0.8236
AT3G25250		AtOXI1, OXI1, A...	oxidative signal-inducible1, A...		Lus10038221 [exp]	14.8	0.8007
AT3G05200		ATL6	RING/U-box superfamily protein...		Lus10031515 [exp]	15.1	0.8222
AT2G37730			Protein of unknown function (D...		Lus10024364 [exp]	17.9	0.7675

Compare expression of checked genes

Lus10039856 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.