Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G58150 56 / 3e-11 Optic atrophy 3 protein (OPA3) (.1) AT1G28510 55 / 8e-11 Optic atrophy 3 protein (OPA3) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005273 [exp] 63 / 5e-14 AT1G28510 239 / 1e-81 Optic atrophy 3 protein (OPA3) (.1) Lus10013949 [exp] 63 / 5e-14 AT1G28510 238 / 3e-81 Optic atrophy 3 protein (OPA3) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G059800 [exp] 77 / 3e-19 AT1G28510 186 / 9e-61 Optic atrophy 3 protein (OPA3) (.1) Potri.013G123000 [exp] 64 / 2e-14 AT1G28510 174 / 3e-56 Optic atrophy 3 protein (OPA3) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07047 [flax] [poplar] OPA3 Optic atrophy 3 protein (OPA3)
Representative CDS sequence Show only first row Show all	>Lus10039862 pacid=23165015 polypeptide=Lus10039862 locus=Lus10039862.g ID=Lus10039862.BGIv1.0 annot-version=v1.0 ATGAAAGCAGATTTTGACAGTTTGAAATTTCAGGTTGCTGGAGCAGCAATCATCTACGAAGTGCAAAGAAACGCTAGATCAGAAGCGAAAAAGGAAGAGC TTCGGAAACGTGTTCTGCAGGAGATGAAGCAAAGGGAGGAAGATCTAGGCAGAGAAGTTGAGATTCTTAAACACAGGCTTACAGAGCTCGCACAACAAGA GCTCAAGAACGAAGGCTCCAAAAAGTGGATTTAA
AA sequence Show only first row Show all	>Lus10039862 pacid=23165015 polypeptide=Lus10039862 locus=Lus10039862.g ID=Lus10039862.BGIv1.0 annot-version=v1.0 MKADFDSLKFQVAGAAIIYEVQRNARSEAKKEELRKRVLQEMKQREEDLGREVEILKHRLTELAQQELKNEGSKKWI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G58150			Optic atrophy 3 protein (OPA3)...		Lus10039862 [exp]	0	1
					Lus10011642 [exp]	3.7	1.0000
AT1G23420	YABBY	INO, YAB4	INNER NO OUTER, Plant-specific...		Lus10013028 [exp]	4.6	1.0000
					Lus10022214 [exp]	5.3	1.0000
					Lus10011425 [exp]	5.4	1.0000
					Lus10027991 [exp]	6.5	1.0000
					Lus10035592 [exp]	8.4	1.0000
AT2G20420			ATP citrate lyase (ACL) family...		Lus10022902 [exp]	11.4	1.0000
AT1G75290			NAD(P)-binding Rossmann-fold s...		Lus10035058 [exp]	12.7	1.0000
AT5G14180		MPL1	Myzus persicae-induced lipase ...		Lus10031524 [exp]	14.2	1.0000
AT1G06620			2-oxoglutarate (2OG) and Fe(II...		Lus10017080 [exp]	14.7	1.0000

Compare expression of checked genes

Lus10039862 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.