Lus10039863 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70870 40 / 8e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70840 40 / 0.0002 MLP31 MLP-like protein 31 (.1)
AT1G70850 39 / 0.0005 MLP34 MLP-like protein 34 (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039864 194 / 4e-63 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1)
Lus10002175 163 / 2e-52 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10002174 152 / 6e-48 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039891 149 / 1e-46 AT5G28010 59 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10018627 138 / 2e-43 ND /
Lus10002176 87 / 2e-22 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2)
Lus10039892 64 / 5e-14 ND 41 / 9e-06
Lus10030840 52 / 1e-08 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Lus10028887 47 / 4e-07 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G020000 49 / 1e-07 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.017G051100 44 / 4e-06 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1)
Potri.017G051200 42 / 1e-05 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1)
Potri.008G131200 41 / 5e-05 AT1G14930 122 / 4e-36 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Potri.004G020100 41 / 5e-05 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10039863 pacid=23165291 polypeptide=Lus10039863 locus=Lus10039863.g ID=Lus10039863.BGIv1.0 annot-version=v1.0
ATGGCGGCTAGGATTCACAAGTTTGAGGCTAAGTTTCCGATGAAATCTCCTGAGAAGCTGGTTGGTTTCTTCAGGAACCATTTCTGCGACCTGCCTCAAC
TGGTTCCGGCTATGATCAAGACCTCCAAGATTATCGGCGGAGGGTCGAAGATGGGTCCTGGCTCCGTCTTCCACGTCACTTACTCCCTCCCTGGAATTCC
GAGCCTAGTGAGTATAAAGATGAAGGTGGAAGAGATGGACGACGAAGCTGCGGGAAGCAAGTTGATGACGCTCAGGACGATCGAATGGGACTTGATGCAT
AAATACCCTAGTTACGTTGCCAGAGCTGAGATCGATGCCGGCGGCAAGCATGTTAAATGGTCGGTCGAGTACGAGAAGGCCGATCCGAGCGTTCCTGCTC
CTCTCGAATACATCGAGCTTTACAAAATCATGTGCAGCGGCTCCAACCATTATTAA
AA sequence
>Lus10039863 pacid=23165291 polypeptide=Lus10039863 locus=Lus10039863.g ID=Lus10039863.BGIv1.0 annot-version=v1.0
MAARIHKFEAKFPMKSPEKLVGFFRNHFCDLPQLVPAMIKTSKIIGGGSKMGPGSVFHVTYSLPGIPSLVSIKMKVEEMDDEAAGSKLMTLRTIEWDLMH
KYPSYVARAEIDAGGKHVKWSVEYEKADPSVPAPLEYIELYKIMCSGSNHY

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28010 Polyketide cyclase/dehydrase a... Lus10039863 0 1
AT5G14180 MPL1 Myzus persicae-induced lipase ... Lus10031524 8.6 0.9965
Lus10011425 12.2 0.9965
AT1G29010 unknown protein Lus10013977 12.8 0.9525
Lus10011078 14.9 0.9965
Lus10022518 17.2 0.9965
AT2G39510 nodulin MtN21 /EamA-like trans... Lus10040310 17.7 0.9852
AT4G18840 Pentatricopeptide repeat (PPR-... Lus10036420 18.4 0.8803
AT2G39510 nodulin MtN21 /EamA-like trans... Lus10023431 19.2 0.9965
AT3G15670 Late embryogenesis abundant pr... Lus10004395 19.9 0.9635
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10025669 21.1 0.9965

Lus10039863 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.