Lus10039865 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018628 98 / 1e-25 AT4G35160 192 / 7e-58 O-methyltransferase family protein (.1)
Lus10001510 76 / 1e-17 AT4G35160 197 / 1e-59 O-methyltransferase family protein (.1)
Lus10018629 74 / 1e-16 AT4G35160 214 / 3e-66 O-methyltransferase family protein (.1)
Lus10017691 64 / 2e-13 AT4G35160 194 / 2e-58 O-methyltransferase family protein (.1)
Lus10033656 52 / 4e-09 AT4G35150 211 / 8e-65 O-methyltransferase family protein (.1)
Lus10033653 52 / 4e-09 AT4G35150 172 / 2e-50 O-methyltransferase family protein (.1)
Lus10033655 51 / 9e-09 AT4G35150 193 / 3e-58 O-methyltransferase family protein (.1)
Lus10017699 49 / 4e-08 AT4G35150 204 / 2e-62 O-methyltransferase family protein (.1)
Lus10018526 47 / 3e-07 AT4G35160 176 / 1e-51 O-methyltransferase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G093100 63 / 4e-13 AT4G35160 225 / 1e-70 O-methyltransferase family protein (.1)
Potri.013G122000 58 / 3e-11 AT4G35160 174 / 6e-51 O-methyltransferase family protein (.1)
Potri.013G120800 58 / 3e-11 AT4G35160 205 / 7e-63 O-methyltransferase family protein (.1)
Potri.013G122400 57 / 9e-11 AT4G35160 188 / 2e-56 O-methyltransferase family protein (.1)
Potri.013G121300 57 / 1e-10 AT4G35160 201 / 4e-61 O-methyltransferase family protein (.1)
Potri.019G093000 56 / 2e-10 AT4G35160 230 / 1e-72 O-methyltransferase family protein (.1)
Potri.013G121400 55 / 3e-10 AT4G35160 202 / 8e-62 O-methyltransferase family protein (.1)
Potri.013G121900 54 / 6e-10 AT4G35160 184 / 5e-55 O-methyltransferase family protein (.1)
Potri.013G120900 52 / 1e-09 AT4G35160 75 / 3e-16 O-methyltransferase family protein (.1)
Potri.011G059600 46 / 4e-07 AT4G35160 196 / 3e-59 O-methyltransferase family protein (.1)
PFAM info
Representative CDS sequence
>Lus10039865 pacid=23165168 polypeptide=Lus10039865 locus=Lus10039865.g ID=Lus10039865.BGIv1.0 annot-version=v1.0
ATGGGATCATTAAGCAATAACGTCGCCGGCGGAAGCACAACCTCGTCGGAGCTCCTCGAAGCTCAGAGCCACGTGTGGCATCGCACCTTCAACTTCGTCA
CCTCCATGTCACTAAAATGTGTCCAGCTCGGCATCCCTGACGCCGTCAACTCTAACGGCGTTGAAAGTCCCACCGACGAAATCCCCCTACCTCCACCGCC
TCCTCCGTGTCCTCGTCCACTCCGGCTTCCTCATCTCCCACAGCGGTGGCGAAAGCTACTCGCTAACACCTGCCGGCAGACTCCTCCTTAA
AA sequence
>Lus10039865 pacid=23165168 polypeptide=Lus10039865 locus=Lus10039865.g ID=Lus10039865.BGIv1.0 annot-version=v1.0
MGSLSNNVAGGSTTSSELLEAQSHVWHRTFNFVTSMSLKCVQLGIPDAVNSNGVESPTDEIPLPPPPPPCPRPLRLPHLPQRWRKLLANTCRQTPP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039865 0 1
AT5G49040 Disease resistance-responsive ... Lus10021082 4.5 0.9327
AT4G24730 Calcineurin-like metallo-phosp... Lus10017960 4.5 0.9090
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10024626 12.2 0.9282
AT5G54010 UDP-Glycosyltransferase superf... Lus10040178 13.0 0.8886
AT5G06490 RING/U-box superfamily protein... Lus10008972 13.7 0.9226
AT1G66470 bHLH AtRHD6, RHD6, b... ROOT HAIR DEFECTIVE6 (.1) Lus10017634 23.2 0.8983
AT5G62620 Galactosyltransferase family p... Lus10004256 23.7 0.9058
AT1G77860 KOM KOMPEITO, Rhomboid-related int... Lus10028036 24.3 0.8616
AT4G12520 Bifunctional inhibitor/lipid-t... Lus10032254 29.5 0.9080
AT3G01516 unknown protein Lus10014544 31.6 0.9027

Lus10039865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.