Lus10039867 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G28480 128 / 5e-39 roxy19, GRX480 Thioredoxin superfamily protein (.1)
AT1G03850 110 / 4e-32 ATGRXS13 glutaredoxin 13, Glutaredoxin family protein (.1.2)
AT4G15700 99 / 1e-27 Thioredoxin superfamily protein (.1)
AT4G15690 98 / 1e-27 Thioredoxin superfamily protein (.1)
AT4G15670 96 / 7e-27 Thioredoxin superfamily protein (.1)
AT4G15680 96 / 1e-26 Thioredoxin superfamily protein (.1)
AT5G18600 96 / 1e-26 Thioredoxin superfamily protein (.1)
AT4G15660 95 / 2e-26 Thioredoxin superfamily protein (.1)
AT5G14070 92 / 1e-24 ROXY2 Thioredoxin superfamily protein (.1)
AT3G02000 88 / 2e-23 ROXY1 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018631 245 / 3e-85 AT1G28480 127 / 8e-39 Thioredoxin superfamily protein (.1)
Lus10013962 131 / 1e-40 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1)
Lus10017693 126 / 8e-39 AT1G28480 100 / 4e-29 Thioredoxin superfamily protein (.1)
Lus10033649 125 / 2e-38 AT1G28480 100 / 5e-29 Thioredoxin superfamily protein (.1)
Lus10041538 108 / 4e-31 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10035183 100 / 5e-28 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10011333 100 / 8e-28 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10038514 94 / 2e-25 AT5G14070 122 / 2e-36 Thioredoxin superfamily protein (.1)
Lus10023295 93 / 5e-25 AT5G14070 123 / 5e-37 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G017300 157 / 3e-50 AT1G28480 132 / 3e-40 Thioredoxin superfamily protein (.1)
Potri.007G134800 156 / 5e-50 AT1G28480 141 / 9e-44 Thioredoxin superfamily protein (.1)
Potri.004G049800 139 / 3e-43 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
Potri.011G058800 129 / 5e-39 AT1G28480 102 / 2e-28 Thioredoxin superfamily protein (.1)
Potri.001G325800 105 / 3e-30 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.001G060600 105 / 5e-30 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.003G167000 104 / 7e-30 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.010G021800 91 / 1e-24 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.008G214500 86 / 8e-23 AT3G21460 177 / 2e-59 Glutaredoxin family protein (.1)
Potri.008G214600 86 / 1e-22 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10039867 pacid=23165373 polypeptide=Lus10039867 locus=Lus10039867.g ID=Lus10039867.BGIv1.0 annot-version=v1.0
ATGCAGGAGGCGATTCCCTACAAGTCATGGCAACCGCAATACACAAAGCAGCCGTTTTTAACCACCGGCGGCGAAGTCCTCCTCCCTGCCACGGCGGCTC
CGGCGGAGGTCGTGTCGGAGAATGCCATCGTGGTATTCGCCAGGAGAGGGTGCTGCATGACCCACGTCGTCAAGCGGCTGCTCCTCTGTTTAGGGGTCAA
CCCACCGGTGTTCGAGGTGGACGATGGCGACGAGGGTCGGGTTTTGAAGGATTTGAAGTTGCCGGCGAAGGTGGCAGTGCAGTTGCCAGCGGTTTTTATT
GGTGGGGAATTGTTTGGTGGGTTGGATAAGGTCATGGCCAGTCATATCGCCGGCGAGTTGGTTCCTCTTCTTAAACAAGCAGGAGCCTTGTGGCTTTGA
AA sequence
>Lus10039867 pacid=23165373 polypeptide=Lus10039867 locus=Lus10039867.g ID=Lus10039867.BGIv1.0 annot-version=v1.0
MQEAIPYKSWQPQYTKQPFLTTGGEVLLPATAAPAEVVSENAIVVFARRGCCMTHVVKRLLLCLGVNPPVFEVDDGDEGRVLKDLKLPAKVAVQLPAVFI
GGELFGGLDKVMASHIAGELVPLLKQAGALWL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G28480 roxy19, GRX480 Thioredoxin superfamily protei... Lus10039867 0 1
AT1G32160 Protein of unknown function (D... Lus10035392 1.4 0.9879
AT3G05550 Hypoxia-responsive family prot... Lus10029883 2.8 0.9861
AT5G19140 AtAILP1, AILP1 Aluminium induced protein with... Lus10034038 3.5 0.9797
AT5G60335 Thioesterase superfamily prote... Lus10031971 4.0 0.9877
AT1G09090 ATRBOHB-BETA, A... respiratory burst oxidase homo... Lus10020644 5.2 0.9867
AT1G71695 Peroxidase superfamily protein... Lus10028689 5.9 0.9854
AT4G10950 SGNH hydrolase-type esterase s... Lus10032399 6.0 0.9805
AT1G72360 AP2_ERF AtERF73, HRE1 HYPOXIA RESPONSIVE ERF \(ETHYL... Lus10003601 6.0 0.9850
AT2G30490 REF3, CYP73A5, ... REDUCED EPRDERMAL FLUORESCENCE... Lus10027598 7.0 0.9836
AT2G37040 PAL1, ATPAL1 PHE ammonia lyase 1 (.1) Lus10026518 7.0 0.9689

Lus10039867 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.