Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G46090 105 / 2e-29 Protein of unknown function (DUF679) (.1) AT4G18425 99 / 6e-27 Protein of unknown function (DUF679) (.1) AT4G28485 96 / 2e-26 AtDMP7 Arabidopsis thaliana DUF679 domain membrane protein 7, DUF679 domain membrane protein 7 (.1) AT4G24310 86 / 5e-22 Protein of unknown function (DUF679) (.1) AT3G02430 81 / 8e-20 Protein of unknown function (DUF679) (.1) AT3G21550 58 / 1e-11 AtDMP2 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) AT3G21520 56 / 9e-11 AtDMP1 Arabidopsis thaliana DUF679 domain membrane protein 1, DUF679 domain membrane protein 1 (.1) AT1G09157 51 / 1e-08 Protein of unknown function (DUF679) (.1) AT5G39650 50 / 2e-08 DAU2 DUO1-activated unknown 2, Protein of unknown function (DUF679) (.1) AT5G27370 45 / 1e-06 Protein of unknown function (DUF679) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018635 [exp] 150 / 4e-47 AT5G46090 192 / 8e-62 Protein of unknown function (DUF679) (.1) Lus10033645 [exp] 139 / 8e-43 AT5G46090 208 / 2e-68 Protein of unknown function (DUF679) (.1) Lus10017689 [exp] 136 / 1e-41 AT5G46090 197 / 8e-64 Protein of unknown function (DUF679) (.1) Lus10015394 [exp] 104 / 6e-29 AT4G18425 273 / 1e-93 Protein of unknown function (DUF679) (.1) Lus10013969 [exp] 103 / 1e-28 AT4G18425 274 / 5e-94 Protein of unknown function (DUF679) (.1) Lus10013975 [exp] 102 / 5e-28 AT4G18425 257 / 3e-87 Protein of unknown function (DUF679) (.1) Lus10013971 [exp] 102 / 7e-28 AT5G46090 234 / 2e-78 Protein of unknown function (DUF679) (.1) Lus10015396 [exp] 99 / 1e-26 AT5G46090 239 / 3e-80 Protein of unknown function (DUF679) (.1) Lus10013974 [exp] 96 / 1e-25 AT4G18425 238 / 1e-79 Protein of unknown function (DUF679) (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G016300 [exp] 117 / 3e-34 AT4G18425 203 / 2e-66 Protein of unknown function (DUF679) (.1) Potri.011G058000 [exp] 113 / 2e-32 AT4G18425 247 / 8e-84 Protein of unknown function (DUF679) (.1) Potri.004G049000 [exp] 107 / 5e-30 AT4G18425 276 / 6e-95 Protein of unknown function (DUF679) (.1) Potri.004G223500 [exp] 83 / 1e-20 AT3G02430 195 / 1e-62 Protein of unknown function (DUF679) (.1) Potri.003G008600 [exp] 82 / 3e-20 AT3G02430 185 / 6e-59 Protein of unknown function (DUF679) (.1) Potri.010G168400 [exp] 65 / 1e-13 AT1G09157 223 / 2e-73 Protein of unknown function (DUF679) (.1) Potri.008G087000 [exp] 64 / 1e-13 AT1G09157 254 / 1e-85 Protein of unknown function (DUF679) (.1) Potri.013G116300 [exp] 62 / 9e-13 AT3G02430 94 / 9e-24 Protein of unknown function (DUF679) (.1) Potri.010G027600 [exp] 61 / 2e-12 AT3G21550 202 / 1e-66 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1) Potri.008G115100 [exp] 55 / 3e-10 AT3G21550 213 / 9e-71 Arabidopsis thaliana DUF679 domain membrane protein 2, DUF679 domain membrane protein 2 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05078 [flax] [poplar] DUF679 Protein of unknown function (DUF679)
Representative CDS sequence Show only first row Show all	>Lus10039871 pacid=23165327 polypeptide=Lus10039871 locus=Lus10039871.g ID=Lus10039871.BGIv1.0 annot-version=v1.0 ATGAACTCGTCGCTTACCATGTATGGCTTGGCGGCGTTCAACGGGCTATGGGTGATGGACGGCTCGATGAAGCTATCCCCTGAGGAAGCGAGCCAATACA GGTTGAGGTTCTTGGACGTGTTCCACGCGACGATGAGCGCGATGGTGTTCGGTGCGGTGGCATTGTTCGATAAGAACGTCGTGAGCTGCTTGTTCCCCGA GCCGGCAGAGGAGACGAAGGAGTTGCTTTCCAAGTTACCGTTTGGAGTTGGGTTGGTCGGTAGTTTGTTGTTCCTTGCATTCCCTACTAAACGACATGGG ATTGGGACCCCTGTATCTCAGGAATGA
AA sequence Show only first row Show all	>Lus10039871 pacid=23165327 polypeptide=Lus10039871 locus=Lus10039871.g ID=Lus10039871.BGIv1.0 annot-version=v1.0 MNSSLTMYGLAAFNGLWVMDGSMKLSPEEASQYRLRFLDVFHATMSAMVFGAVALFDKNVVSCLFPEPAEETKELLSKLPFGVGLVGSLLFLAFPTKRHG IGTPVSQE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G46090			Protein of unknown function (D...		Lus10039871 [exp]	0	1

Compare expression of checked genes

Lus10039871 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.