Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G44170 102 / 6e-29 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018640 [exp] 128 / 6e-39 AT5G44170 348 / 1e-122 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G017000 [exp] 101 / 9e-29 AT5G44170 316 / 3e-110 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039875 pacid=23165386 polypeptide=Lus10039875 locus=Lus10039875.g ID=Lus10039875.BGIv1.0 annot-version=v1.0 ATGGAGTCCCTGATGGCCGACGACGGCGTGGTGCTGCTTGGGTATCAGTTGAGGTCTCCAGAAGCTCATAAGCTGTTCTGGGAAATGTCCGAGGTGTTCG AGATCGAGAAGATTCCTCATGAAGATTTGCATCCTGATTATGCCTACGAAGAGACTGATGTCTACGTTTTCCGCAAGAAGAAGAAACAACAGTAG
AA sequence Show only first row Show all	>Lus10039875 pacid=23165386 polypeptide=Lus10039875 locus=Lus10039875.g ID=Lus10039875.BGIv1.0 annot-version=v1.0 MESLMADDGVVLLGYQLRSPEAHKLFWEMSEVFEIEKIPHEDLHPDYAYEETDVYVFRKKKKQQ

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G44170			S-adenosyl-L-methionine-depend...		Lus10039875 [exp]	0	1
AT2G17265		DMR1, HSK	DOWNY MILDEW RESISTANT 1, homo...		Lus10001387 [exp]	5.5	0.8325
AT1G27970		NTF2B	nuclear transport factor 2B (....		Lus10032033 [exp]	9.4	0.8268
AT1G44414			unknown protein		Lus10018166 [exp]	15.1	0.8029
AT2G47840		AtTic20-II	translocon at the inner envelo...		Lus10026842 [exp]	15.2	0.7954
AT4G17600		LIL3:1	Chlorophyll A-B binding family...		Lus10011016 [exp]	16.2	0.8110
AT4G26500		SUFE1, EMB1374,...	SULFUR E 1, MBRYO DEFECTIVE 13...		Lus10032905 [exp]	24.6	0.7767
AT3G55550			Concanavalin A-like lectin pro...		Lus10040276 [exp]	25.1	0.7683
AT4G28230			unknown protein		Lus10033724 [exp]	25.5	0.7766
AT5G12190			RNA-binding (RRM/RBD/RNP motif...		Lus10026814 [exp]	28.9	0.7581
AT1G27190			Leucine-rich repeat protein ki...		Lus10013288 [exp]	30.0	0.7772

Compare expression of checked genes

Lus10039875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.