Lus10039876 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G44170 194 / 4e-63 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
AT1G08125 64 / 2e-12 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018640 224 / 6e-75 AT5G44170 348 / 1e-122 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Lus10021425 61 / 3e-11 AT1G08125 385 / 2e-135 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2.3)
Lus10016141 41 / 0.0001 AT1G08125 183 / 7e-56 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G017000 179 / 2e-57 AT5G44170 316 / 3e-110 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1)
Potri.009G006800 64 / 2e-12 AT1G08125 370 / 4e-129 S-adenosyl-L-methionine-dependent methyltransferases superfamily protein (.1.2.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0063 NADP_Rossmann PF10294 Methyltransf_16 Lysine methyltransferase
Representative CDS sequence
>Lus10039876 pacid=23165061 polypeptide=Lus10039876 locus=Lus10039876.g ID=Lus10039876.BGIv1.0 annot-version=v1.0
ATGAAGTTCACAGACTCGCCGGTGATCGATCTCCAAATCGGCGACAAGCACCTCTCAATTCAACAAGACAACGGCTCGATGCACGTCGGCACCTCCGTCT
GGCCCTGCTCCCTTGTACTCGCCAAGTTCATCGAGCGCTGGTCGGCAACATCACCGGCACCCTCCAGCTCCAGCTCCACCTCCACCTCCGCCGCCAAAAA
CCCTTACTCCTCCCTCCTGGACTTCCGCTCCAAACGCCGCCGCGCAGTCGAGCTAGGAACAGGCTGCGGAGCCGCCGGGATGGCGCTCCACCTACTCGGG
CTCACCGACATCATCCTCACAGATATCGCCCCCGTGATGCCGGCGCTGAAGCACAACCTCAAGCGGAACAAGCAAACCCTAGGTAAGATGCTGAAAACCT
CCATCTTGTACTGGAACAATCAGGACCAGATGCGATCGCTCAACCCGCCGTTCGACTTCGTGGTGGCGGCAGATGTGGTGTACATCGAGGAATCGGTCGG
GTAG
AA sequence
>Lus10039876 pacid=23165061 polypeptide=Lus10039876 locus=Lus10039876.g ID=Lus10039876.BGIv1.0 annot-version=v1.0
MKFTDSPVIDLQIGDKHLSIQQDNGSMHVGTSVWPCSLVLAKFIERWSATSPAPSSSSSTSTSAAKNPYSSLLDFRSKRRRAVELGTGCGAAGMALHLLG
LTDIILTDIAPVMPALKHNLKRNKQTLGKMLKTSILYWNNQDQMRSLNPPFDFVVAADVVYIEESVG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G44170 S-adenosyl-L-methionine-depend... Lus10039876 0 1
AT2G32600 hydroxyproline-rich glycoprote... Lus10021506 2.2 0.8728
AT2G31160 OBO1, LSH3 ORGAN BOUNDARY 1, LIGHT SENSIT... Lus10024901 2.8 0.8553
AT3G07260 FHA SMAD/FHA domain-containing pro... Lus10038196 2.8 0.8361
AT4G28730 GrxC5 glutaredoxin C5, Glutaredoxin ... Lus10011915 6.9 0.8471
AT4G23630 RTNLB1, BTI1 Reticulan like protein B1, VIR... Lus10032313 8.4 0.8286
AT5G11770 NADH-ubiquinone oxidoreductase... Lus10039485 9.5 0.8287
AT5G08060 unknown protein Lus10034681 14.0 0.8053
AT1G64450 Glycine-rich protein family (.... Lus10023071 14.0 0.8300
AT3G45980 H2B, HTB9 HISTONE H2B, Histone superfami... Lus10005897 15.3 0.7822
AT1G27050 HD ATHB54 homeobox protein 54 (.1) Lus10036708 15.6 0.7908

Lus10039876 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.