Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018647 [exp] 100 / 1e-28 AT5G09520 45 / 5e-07 Pro-Glu-Leu|Ile|Val-Pro-Lys 2, hydroxyproline-rich glycoprotein family protein (.1) Lus10039882 [exp] 72 / 2e-17 AT1G44224 37 / 0.001 ECA1 gametogenesis related family protein (.1) Lus10018648 [exp] 68 / 6e-16 ND 38 / 4e-04 Lus10018643 [exp] 40 / 3e-05 ND / Lus10018645 [exp] 39 / 0.0001 ND 35 / 0.004 Lus10029845 [exp] 38 / 0.0003 AT4G38080 40 / 6e-05 hydroxyproline-rich glycoprotein family protein (.1)
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039881 pacid=23165285 polypeptide=Lus10039881 locus=Lus10039881.g ID=Lus10039881.BGIv1.0 annot-version=v1.0 ATGGCTACTCCATCCAAGTCCTCCATCTTCCTCCTCTTCGCCATCTTCTTCGCCGTCTCGTTCTCCAACGTCCAAGTTGGAACCTCAGCTCGCCAGCTCC TCCAGCTCCCCATCCCTGCCGTCGGAAGTGTCATCCCGAACCTGCCGATGCCCCAGCTGCCCCCACTTCCCGCCGGCCTTCCTGGAATCCCGGCCATTCC CGGGGTTCCCGGAATTCCTTCTGTCCCGAAGGTCCCTGAGCTCCCTGCAGTCACCGCTCTCCCGGTTCCTAACATCCCCAAGATCCCAGGAGTGCCTGGA AACTAA
AA sequence Show only first row Show all	>Lus10039881 pacid=23165285 polypeptide=Lus10039881 locus=Lus10039881.g ID=Lus10039881.BGIv1.0 annot-version=v1.0 MATPSKSSIFLLFAIFFAVSFSNVQVGTSARQLLQLPIPAVGSVIPNLPMPQLPPLPAGLPGIPAIPGVPGIPSVPKVPELPAVTALPVPNIPKIPGVPG N

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Lus10039881 [exp]	0	1
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Lus10018647 [exp]	2.4	0.8805
AT1G29050		TBL38	TRICHOME BIREFRINGENCE-LIKE 38...		Lus10013929 [exp]	6.2	0.8131
AT4G12110		ATSMO1-1, SMO1-...	sterol-4alpha-methyl oxidase 1...		Lus10004321 [exp]	6.9	0.8300
AT1G71680			Transmembrane amino acid trans...		Lus10037052 [exp]	6.9	0.8308
AT3G62650			unknown protein		Lus10010026 [exp]	6.9	0.8201
AT1G20510		OPCL1	OPC-8:0 CoA ligase1 (.1.2)		Lus10015999 [exp]	9.2	0.8309
					Lus10018648 [exp]	11.5	0.8258
AT4G34810			SAUR-like auxin-responsive pro...		Lus10042379 [exp]	13.4	0.8140
AT1G22360		ATUGT85A2, AT2	UDP-glucosyl transferase 85A2 ...		Lus10035903 [exp]	14.7	0.8177
AT3G16370			GDSL-like Lipase/Acylhydrolase...		Lus10006856 [exp]	15.8	0.8280

Compare expression of checked genes

Lus10039881 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.