Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018648 [exp] 81 / 6e-21 ND 38 / 4e-04 Lus10039881 [exp] 72 / 2e-17 AT5G09520 44 / 1e-06 Pro-Glu-Leu|Ile|Val-Pro-Lys 2, hydroxyproline-rich glycoprotein family protein (.1) Lus10018647 [exp] 70 / 8e-17 AT5G09520 45 / 5e-07 Pro-Glu-Leu|Ile|Val-Pro-Lys 2, hydroxyproline-rich glycoprotein family protein (.1) Lus10018645 [exp] 44 / 1e-06 ND 35 / 0.004 Lus10029845 [exp] 38 / 0.0003 AT4G38080 40 / 6e-05 hydroxyproline-rich glycoprotein family protein (.1) Lus10018643 [exp] 36 / 0.001 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039882 pacid=23165174 polypeptide=Lus10039882 locus=Lus10039882.g ID=Lus10039882.BGIv1.0 annot-version=v1.0 ATGGCTACTCCATCCAAGTCCTCCATCTTCCTCCTCTTCGCCATCTTCGTCGCCGTCTCGTTCTCCAACGTCCAAGTTGGAACCTCAGCTCGCCTCCTCC TCCAGCTACCGAATATCCCTGCCGTTGGCGGTGTCCTTCCGATGCCCCAGCTGCCTCCACTCCCCACCACCGGCGGCATCATCCCTACTGTTCCTGGAAT CCCATCCATTCCCACTATTCCAACTATCCCCGCTGTTCCTGGAATCCCTGCGGTGCCGAATGTCCCGGTGCCTCCGGTCACTGGAGCCGTTGCCGGCGTC CCCATTCCTAACCTCCCGGTGCCTTGA
AA sequence Show only first row Show all	>Lus10039882 pacid=23165174 polypeptide=Lus10039882 locus=Lus10039882.g ID=Lus10039882.BGIv1.0 annot-version=v1.0 MATPSKSSIFLLFAIFVAVSFSNVQVGTSARLLLQLPNIPAVGGVLPMPQLPPLPTTGGIIPTVPGIPSIPTIPTIPAVPGIPAVPNVPVPPVTGAVAGV PIPNLPVP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G44224			ECA1 gametogenesis related fam...		Lus10039882 [exp]	0	1
AT5G09520		PELPK2	Pro-Glu-Leu|Ile|Val-Pro-Lys 2,...		Lus10018647 [exp]	1.4	0.9263
					Lus10018648 [exp]	2.0	0.9033
AT3G49720			unknown protein		Lus10007228 [exp]	6.5	0.8901
AT2G45970		CYP86A8, LCR	LACERATA, "cytochrome P450, fa...		Lus10017789 [exp]	10.9	0.8601
AT4G24220		5[beta]-StR, 5[...	VEIN PATTERNING 1, Δ4,5-s...		Lus10032854 [exp]	11.5	0.8265
AT5G65650			Protein of unknown function (D...		Lus10014322 [exp]	13.9	0.8331
AT4G14750		IQD19	IQ-domain 19 (.1)		Lus10039366 [exp]	16.7	0.7984
AT5G54000			2-oxoglutarate (2OG) and Fe(II...		Lus10008822 [exp]	26.5	0.7938
AT5G59530			2-oxoglutarate (2OG) and Fe(II...		Lus10022196 [exp]	27.2	0.8271
AT1G53470		MSL4	mechanosensitive channel of sm...		Lus10042499 [exp]	27.3	0.8213

Compare expression of checked genes

Lus10039882 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.