Lus10039884 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033722 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039884 pacid=23165159 polypeptide=Lus10039884 locus=Lus10039884.g ID=Lus10039884.BGIv1.0 annot-version=v1.0
ATGACACGACTTCCAAAGGTGGTTCGTGAAACGGCGGCGCAGGGGGTTAGGCTTCGGTCCAAAATTCGACGATCTGTCTCTGTAAATGTCATGATGTGGA
TGGAGTACGGTGCTAACAGTTTGGGGAGGCAACTTCTTCAGATTCTGTTGGTTGCTGCGATACAGAGTGTAACAGTCCTGGAACCCCTGTGGGACTCCTC
GAAAGTGATAGTTCTGAGATACATACACCTTCAGTTTTTCCTCTTGTCTTTCTTGCAAGAAGAAGACGAGGTCGATGAGGATGAGGCCTTTGAAGCTGCT
ACGCGGGAAGTGGTCGGGATAATCGAGATGGAATGCAACGGCTCAAGGGAGGAAGGTATAGCAGTAGCGATTTCGACGGCCAAGGAGCTCAAGGGATAA
AA sequence
>Lus10039884 pacid=23165159 polypeptide=Lus10039884 locus=Lus10039884.g ID=Lus10039884.BGIv1.0 annot-version=v1.0
MTRLPKVVRETAAQGVRLRSKIRRSVSVNVMMWMEYGANSLGRQLLQILLVAAIQSVTVLEPLWDSSKVIVLRYIHLQFFLLSFLQEEDEVDEDEAFEAA
TREVVGIIEMECNGSREEGIAVAISTAKELKG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039884 0 1
AT3G26880 Plant self-incompatibility pro... Lus10025935 7.4 0.6705
AT3G12620 Protein phosphatase 2C family ... Lus10040346 23.3 0.6530
Lus10042018 49.6 0.5671
AT1G31320 AS2 LBD4 LOB domain-containing protein ... Lus10031769 63.7 0.5629
AT3G56950 SIP2;1, SIP2 small and basic intrinsic prot... Lus10027275 66.0 0.5632
AT4G21200 ATGA2OX8 ARABIDOPSIS THALIANA GIBBERELL... Lus10013069 83.1 0.5587
AT5G52020 AP2_ERF Integrase-type DNA-binding sup... Lus10017830 101.7 0.5479
Lus10002746 146.7 0.5324
AT2G43020 ATPAO2 polyamine oxidase 2 (.1) Lus10005021 214.1 0.4987

Lus10039884 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.