Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20585 68 / 3e-16 NFD6 nuclear fusion defective 6 (.1.2.3) AT1G28395 62 / 1e-13 unknown protein AT2G33847 59 / 2e-12 unknown protein AT1G55205 43 / 3e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002171 [exp] 112 / 1e-33 AT2G20585 81 / 2e-21 nuclear fusion defective 6 (.1.2.3) Lus10029157 [exp] 48 / 7e-08 AT1G70350 59 / 2e-12 unknown protein Lus10013008 [exp] 45 / 9e-07 AT1G70350 59 / 3e-12 unknown protein Lus10026340 [exp] 39 / 0.0002 AT4G39300 100 / 5e-28 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G137500 [exp] 80 / 1e-20 AT2G20585 66 / 1e-15 nuclear fusion defective 6 (.1.2.3) Potri.004G048100 [exp] 75 / 1e-18 AT1G28395 91 / 1e-25 unknown protein Potri.017G014500 [exp] 72 / 1e-17 AT2G20585 72 / 5e-18 nuclear fusion defective 6 (.1.2.3) Potri.011G057300 [exp] 72 / 2e-17 AT1G28395 103 / 2e-30 unknown protein Potri.006G237800 [exp] 38 / 0.0002 AT5G11630 99 / 8e-29 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039888 pacid=23165058 polypeptide=Lus10039888 locus=Lus10039888.g ID=Lus10039888.BGIv1.0 annot-version=v1.0 ATGGCCACCTTTTCCGCCGCCGGGAGATCCATTTTCCGTTCATCGTCCTCCGCTCGCAATGCGGCGGCTCGGTTCGCCTCCCAAACCAAGGCGGCCCCAA AAGCCTCCCCGAGTTCTGCTTTCCGTACTGCCGCGAACAAGCCTGCATCTCAATCCACTTTCAGGATTCCAGTGGAGATGACCTTTGCAGTGGAATCGAT GATGCCGTACCACACAGTGACTGCTTCGGCTTTGATGACCTCGATGCTTTCCATCTCTCAGCGTAGCTATGGATGGCTTCCTGAAGTTGCTGAGTCAACT CCTTTAGTTACAGCTGAAGTGTTCCTCTTAGCAAAATACTAG
AA sequence Show only first row Show all	>Lus10039888 pacid=23165058 polypeptide=Lus10039888 locus=Lus10039888.g ID=Lus10039888.BGIv1.0 annot-version=v1.0 MATFSAAGRSIFRSSSSARNAAARFASQTKAAPKASPSSAFRTAANKPASQSTFRIPVEMTFAVESMMPYHTVTASALMTSMLSISQRSYGWLPEVAEST PLVTAEVFLLAKY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20585		NFD6	nuclear fusion defective 6 (.1...		Lus10039888 [exp]	0	1
AT5G18380			Ribosomal protein S5 domain 2-...		Lus10034378 [exp]	2.2	0.9229
AT2G37020			Translin family protein (.1.2)		Lus10020710 [exp]	4.2	0.9196
AT3G20430			unknown protein		Lus10000887 [exp]	7.3	0.8697
AT3G18880			Nucleic acid-binding, OB-fold-...		Lus10017467 [exp]	10.8	0.8755
AT1G71350			eukaryotic translation initiat...		Lus10041458 [exp]	11.0	0.8677
AT3G44750		HDT1, HDA3, ATH...	HISTONE DEACETYLASE 2A, histon...		Lus10009390 [exp]	15.2	0.8895
AT5G03740	C2H2ZnF	HD2C, HDT3	HISTONE DEACETYLASE 3, histone...		Lus10020541 [exp]	16.9	0.8845
AT3G55280		RPL23A2, RPL23A...	RIBOSOMAL PROTEIN L23A2, ribos...		Lus10030325 [exp]	20.2	0.8965
AT2G42740		RPL16A	ribosomal protein large subuni...		Lus10033607 [exp]	20.5	0.9134
AT3G04770		RPSAB	40s ribosomal protein SA B (.1...		Lus10037445 [exp]	20.7	0.9082

Compare expression of checked genes

Lus10039888 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.