Lus10039891 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G28010 58 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT5G28000 57 / 8e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G70840 47 / 6e-07 MLP31 MLP-like protein 31 (.1)
AT1G35260 44 / 8e-06 MLP165 MLP-like protein 165 (.1)
AT1G70830 43 / 2e-05 MLP28 MLP-like protein 28 (.1.2.3.4.5)
AT1G70850 43 / 2e-05 MLP34 MLP-like protein 34 (.1.2.3)
AT1G23130 42 / 2e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
AT1G23120 41 / 8e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002174 283 / 7e-100 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10002175 243 / 8e-84 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039863 149 / 1e-46 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
Lus10039864 134 / 1e-39 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1)
Lus10039892 122 / 2e-37 ND 41 / 9e-06
Lus10018627 96 / 2e-26 ND /
Lus10002176 81 / 5e-20 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2)
Lus10030840 54 / 1e-09 AT1G24020 189 / 2e-62 MLP-like protein 423 (.1.2)
Lus10012742 52 / 8e-09 AT1G70830 158 / 6e-50 MLP-like protein 28 (.1.2.3.4.5)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G131100 39 / 0.0003 AT1G70890 107 / 3e-30 MLP-like protein 43 (.1)
Potri.004G051500 38 / 0.0006 AT5G28010 69 / 4e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0209 Bet_v_1_like PF00407 Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence
>Lus10039891 pacid=23165106 polypeptide=Lus10039891 locus=Lus10039891.g ID=Lus10039891.BGIv1.0 annot-version=v1.0
ATGGCGGCTCAGACTCACAAGCTAGAGGTTGAGGTAACAATGAAATCACCAGAGAAGCTGGTGTCTTTCTACAGGAACCATGTCCTCGAAACGCCAAAAC
TGGCTCCTCCGATCATCAAGGCGTGCGAGATCATTGGCGGAGGCACCCAAATGGGTCCAGGCTCCGTTTTCCACGTCACTTACATCCTCCCTGGGATGAC
TGAAGTGGTGAGTGCCAAGGGACTGTTGGGAGATGTAGACGAAGTAGGAGGGAAGTACTTGTCATTCACGGTGATCGAAGGGGAGATGTTACAGAAGTAT
CCTACTTTCATCTCAAGTGCTACGATCGTCGGCAACGAGGTTACCTGGACTCTCGAGTACGAGAAGACGGATTCGAGCACCCTTCCTCCTCTCGAATATG
TTCCTCTATATACGCTCCTCACCCAAGCCTTCGACAACTTCAATTGCTGA
AA sequence
>Lus10039891 pacid=23165106 polypeptide=Lus10039891 locus=Lus10039891.g ID=Lus10039891.BGIv1.0 annot-version=v1.0
MAAQTHKLEVEVTMKSPEKLVSFYRNHVLETPKLAPPIIKACEIIGGGTQMGPGSVFHVTYILPGMTEVVSAKGLLGDVDEVGGKYLSFTVIEGEMLQKY
PTFISSATIVGNEVTWTLEYEKTDSSTLPPLEYVPLYTLLTQAFDNFNC

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G28010 Polyketide cyclase/dehydrase a... Lus10039891 0 1
AT2G02950 PKS1 phytochrome kinase substrate 1... Lus10030480 1.7 0.9859
AT1G14960 Polyketide cyclase/dehydrase a... Lus10042489 2.4 0.9851
AT1G14280 PKS2 phytochrome kinase substrate 2... Lus10012831 4.2 0.9818
AT3G09870 SAUR-like auxin-responsive pro... Lus10030263 4.5 0.9661
AT5G39790 5'-AMP-activated protein kinas... Lus10028512 4.5 0.9400
Lus10041636 4.6 0.9637
AT1G13570 F-box/RNI-like superfamily pro... Lus10011048 6.3 0.9634
AT5G67360 ARA12 Subtilase family protein (.1) Lus10029575 6.6 0.9565
Lus10008816 7.7 0.9659
AT5G64330 JK218, RPT3, NP... ROOT PHOTOTROPISM 3, NON-PHOTO... Lus10015169 7.7 0.9650

Lus10039891 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.