Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70870 40 / 2e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT5G28010 38 / 0.0001 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70840 38 / 0.0001 MLP31 MLP-like protein 31 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002175 [exp] 136 / 4e-43 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039891 [exp] 122 / 1e-37 AT5G28010 59 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002174 [exp] 119 / 4e-36 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039864 [exp] 67 / 6e-15 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1) Lus10039863 [exp] 63 / 3e-14 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039893 [exp] 44 / 2e-07 AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002176 [exp] 40 / 2e-05 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G020000 [exp] 39 / 8e-05 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10039892 pacid=23165021 polypeptide=Lus10039892 locus=Lus10039892.g ID=Lus10039892.BGIv1.0 annot-version=v1.0 ATGTTGGAAGATGTAGACGAGGTTGGAGGGAAGTACATGACAATCACGGTGACTGAAGGGGACATGTTGCAGAAGTATCCTACTTTCATCTGCAAAGCTG TGGTCGATGGCAGCGAGGTTACCTGGACTGTCGAGTACGAGAAGGCCGATTCGACCACTCTTCCTCCTCTCGAATATGTTCCACTTCTCACGCTCCTCAC CCAAGCCTTCGACAACTTCAATTACTAA
AA sequence Show only first row Show all	>Lus10039892 pacid=23165021 polypeptide=Lus10039892 locus=Lus10039892.g ID=Lus10039892.BGIv1.0 annot-version=v1.0 MLEDVDEVGGKYMTITVTEGDMLQKYPTFICKAVVDGSEVTWTVEYEKADSTTLPPLEYVPLLTLLTQAFDNFNY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039892 [exp]	0	1
AT3G08890			Protein of unknown function, D...		Lus10012498 [exp]	1.0	0.9780
					Lus10032841 [exp]	7.2	0.9563
AT3G15270	SBP	SPL5	squamosa promoter binding prot...		Lus10005548 [exp]	7.5	0.9412
AT3G51550		FER	FERONIA, Malectin/receptor-lik...		Lus10003942 [exp]	7.5	0.9314
AT2G23200			Protein kinase superfamily pro...		Lus10012646 [exp]	8.1	0.9128
AT5G36930			Disease resistance protein (TI...		Lus10007812 [exp]	8.3	0.8975
AT5G01370		ACI1	ALC-interacting protein 1 (.1)		Lus10001252 [exp]	8.7	0.8789
AT5G53130		ATCNGC1, CNGC1	CYCLIC NUCLEOTIDE-GATED CHANNE...		Lus10003396 [exp]	10.4	0.9508
					Lus10032968 [exp]	10.4	0.9648
AT1G33340			ENTH/ANTH/VHS superfamily prot...		Lus10008557 [exp]	12.0	0.8872

Compare expression of checked genes

Lus10039892 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.