Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G70870 53 / 1e-10 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70840 47 / 3e-08 MLP31 MLP-like protein 31 (.1) AT1G70830 46 / 9e-08 MLP28 MLP-like protein 28 (.1.2.3.4.5) AT5G28010 45 / 1e-07 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) AT1G70850 46 / 2e-07 MLP34 MLP-like protein 34 (.1.2.3) AT1G35260 42 / 4e-06 MLP165 MLP-like protein 165 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002176 [exp] 128 / 7e-40 AT1G24020 65 / 7e-14 MLP-like protein 423 (.1.2) Lus10002174 [exp] 54 / 1e-10 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10002175 [exp] 52 / 6e-10 AT5G28010 50 / 4e-08 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039891 [exp] 50 / 3e-09 AT5G28010 59 / 3e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039864 [exp] 48 / 3e-08 AT5G54160 65 / 7e-12 O-methyltransferase 1 (.1) Lus10008930 [exp] 46 / 1e-07 AT5G28010 126 / 2e-37 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10039892 [exp] 44 / 1e-07 ND 41 / 9e-06 Lus10039863 [exp] 45 / 2e-07 AT5G28010 42 / 3e-05 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Lus10028887 [exp] 45 / 3e-07 AT2G01520 129 / 1e-38 \(Zusammen-CA\)-enhanced 1, MLP-like protein 328 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G131300 [exp] 48 / 1e-08 AT1G14930 100 / 1e-27 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G020100 [exp] 48 / 2e-08 AT1G70880 58 / 5e-11 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.004G020000 [exp] 45 / 1e-07 AT1G70880 69 / 3e-15 Polyketide cyclase/dehydrase and lipid transport superfamily protein (.1) Potri.017G051100 [exp] 40 / 1e-05 AT1G70840 115 / 3e-33 MLP-like protein 31 (.1) Potri.017G051200 [exp] 37 / 0.0001 AT1G70840 116 / 3e-34 MLP-like protein 31 (.1) Potri.010G111000 [exp] 37 / 0.0002 AT1G70830 175 / 8e-57 MLP-like protein 28 (.1.2.3.4.5)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0209 [flax] [poplar] Bet_v_1_like PF00407 [flax] [poplar] Bet_v_1 Pathogenesis-related protein Bet v 1 family
Representative CDS sequence Show only first row Show all	>Lus10039893 pacid=23165298 polypeptide=Lus10039893 locus=Lus10039893.g ID=Lus10039893.BGIv1.0 annot-version=v1.0 ATGGACGAAGCAAGGAAGTCGATAACGTTGAAAGTGGTCGGCGGCGATGGGCTCAAGACTTACACAAGTTTTATGTCCAAATGCCAAATTGTTGGGAACA CTGTGAATTGGAGCATTGAGTACGAGAAGGCTACTCCTTCTTCCCCACCTGCTGACCCTTATTTGGAGTTCTACGTCAAACTCTCGAAGACCGTCGACAT ATAA
AA sequence Show only first row Show all	>Lus10039893 pacid=23165298 polypeptide=Lus10039893 locus=Lus10039893.g ID=Lus10039893.BGIv1.0 annot-version=v1.0 MDEARKSITLKVVGGDGLKTYTSFMSKCQIVGNTVNWSIEYEKATPSSPPADPYLEFYVKLSKTVDI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G70870			Polyketide cyclase/dehydrase a...		Lus10039893 [exp]	0	1
AT4G29230	NAC	ANAC075, NST9	NAC domain containing protein ...		Lus10012927 [exp]	7.7	0.7815
AT4G29230	NAC	ANAC075, NST9	NAC domain containing protein ...		Lus10034999 [exp]	11.9	0.7716
AT2G22620			Rhamnogalacturonate lyase fami...		Lus10019231 [exp]	13.3	0.7688
AT5G56270	WRKY	ATWRKY2, WRKY2,...	ARABIDOPSIS THALIANA WRKY DNA-...		Lus10027139 [exp]	14.6	0.7574
AT5G51350		MORE LATERAL GR...	MORE LATERAL GROWTH1, Leucine-...		Lus10019067 [exp]	17.2	0.7492
					Lus10040594 [exp]	17.7	0.6799
AT2G32900		ATZW10	centromere/kinetochore protein...		Lus10029956 [exp]	19.6	0.7240
					Lus10021760 [exp]	19.9	0.7002
AT3G27470			Protein of unknown function (D...		Lus10035228 [exp]	21.4	0.7413
AT2G23770			protein kinase family protein ...		Lus10022488 [exp]	22.9	0.7295

Compare expression of checked genes

Lus10039893 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.