Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039897 pacid=23165204 polypeptide=Lus10039897 locus=Lus10039897.g ID=Lus10039897.BGIv1.0 annot-version=v1.0 ATGGGGATATTGCAAACTGGTGGGATGATTAGCAATATCGTTAGTAATCCAACTAGTAAAGTGAAGAAGGTTGAAGATAGTAACGGTGGGTTTATGGGTC GACATCTGATGTCGACGACTCTGCCGCAACATCAGCATCATCATCATCTGCTACAGAATCAGCATCAATTGCTGCATCAGTTTGCTCACCCTGCTGGGGC TCATCATCATCAATTCTACCAGCTTGATAACCTCCCCATTCCAGGGCAATTTCCAGGGTATAGTTTCAACGGGCAAGTGATGGAGAACAATCTATAG
AA sequence Show only first row Show all	>Lus10039897 pacid=23165204 polypeptide=Lus10039897 locus=Lus10039897.g ID=Lus10039897.BGIv1.0 annot-version=v1.0 MGILQTGGMISNIVSNPTSKVKKVEDSNGGFMGRHLMSTTLPQHQHHHHLLQNQHQLLHQFAHPAGAHHHQFYQLDNLPIPGQFPGYSFNGQVMENNL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039897 [exp]	0	1
AT2G30900		TBL43	TRICHOME BIREFRINGENCE-LIKE 43...		Lus10020786 [exp]	1.0	0.9715
AT2G28085			SAUR-like auxin-responsive pro...		Lus10016130 [exp]	9.0	0.9251
AT5G04870		AK1, ATCPK1, CP...	calcium dependent protein kina...		Lus10029358 [exp]	9.8	0.9380
AT3G27470			Protein of unknown function (D...		Lus10022287 [exp]	15.6	0.8374
					Lus10018225 [exp]	16.7	0.9200
AT3G45400			exostosin family protein (.1)		Lus10020308 [exp]	17.9	0.8082
AT1G19640		JMT	jasmonic acid carboxyl methylt...		Lus10025993 [exp]	18.7	0.7430
					Lus10034684 [exp]	19.0	0.7381
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10028844 [exp]	19.7	0.9134
AT5G59810		ATSBT5.4	Subtilase family protein (.1)		Lus10008982 [exp]	20.4	0.8123

Compare expression of checked genes

Lus10039897 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.