Lus10039907 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G58100 142 / 3e-43 PDCB5 plasmodesmata callose-binding protein 5 (.1)
AT2G30933 92 / 2e-23 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT1G29380 88 / 3e-21 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G66870 82 / 8e-21 Carbohydrate-binding X8 domain superfamily protein (.1)
AT3G55430 88 / 1e-20 O-Glycosyl hydrolases family 17 protein (.1)
AT4G05430 82 / 2e-20 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G66855 81 / 3e-20 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G55180 85 / 1e-19 O-Glycosyl hydrolases family 17 protein (.1.2)
AT5G35740 80 / 1e-19 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G66852 79 / 1e-19 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002193 249 / 1e-85 AT3G58100 155 / 1e-48 plasmodesmata callose-binding protein 5 (.1)
Lus10012324 88 / 1e-22 AT5G35740 164 / 8e-54 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10023276 88 / 5e-22 AT4G05430 146 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10007342 89 / 7e-22 AT2G30933 167 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10020765 89 / 1e-21 AT2G30933 169 / 4e-52 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10038529 87 / 1e-21 AT4G05430 146 / 9e-45 Carbohydrate-binding X8 domain superfamily protein (.1)
Lus10031443 91 / 2e-21 AT2G30933 143 / 2e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Lus10039179 89 / 5e-21 AT3G13560 634 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2.3)
Lus10001516 89 / 7e-21 AT2G30933 143 / 3e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.019G091500 169 / 4e-54 AT3G58100 145 / 2e-44 plasmodesmata callose-binding protein 5 (.1)
Potri.013G119500 145 / 1e-44 AT3G58100 128 / 6e-38 plasmodesmata callose-binding protein 5 (.1)
Potri.013G003500 100 / 6e-25 AT1G09460 144 / 3e-38 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.005G003500 100 / 1e-24 AT2G30933 142 / 1e-38 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.019G007800 94 / 1e-24 AT4G05430 160 / 4e-51 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.019G012000 94 / 1e-24 AT4G05430 155 / 3e-49 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.007G111000 91 / 3e-23 AT4G05430 148 / 5e-46 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.006G016800 88 / 6e-23 AT5G35740 156 / 1e-50 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.002G059600 90 / 3e-22 AT2G30933 164 / 5e-50 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Potri.014G164600 86 / 3e-22 AT5G35740 179 / 8e-60 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Lus10039907 pacid=23165336 polypeptide=Lus10039907 locus=Lus10039907.g ID=Lus10039907.BGIv1.0 annot-version=v1.0
ATGGATTCCAAGTTCAGTCTGTTCCTCCTACTGCTTCTAGCCCTCTGTCTCCCGCCTCTGTGGGCCGATCAGAGCGGCGCGATCGTGCCAAGGGAGCTGT
GGTGCGTGGCGAAGAACAACGCGCCAGACTCTGCGCTCCAGTCGGCCATCGACTGGGCTTGTGGTGCCGGCGGCGCGAATTGCTCTCCGATACAGCAGGG
TGGGCCCTGCTACGACGACAGCGACCTCCAGAGGGCGGCCTCATGGGCTTTCAACGACTACTTCTTGAAGAACGGGATGACCGACGACGCTTGCAACTTC
AGCGACACCGCCGCCCTCATTTCTCTCAACCCCAGCCGTGGCAATTGCAAGTTCCCTTCGAGCCCTGGGACGAGTAGCTTTTCGACAGAAACAACAATGG
GGATGGGGAGGAGCGACAGTGCAGATATGAGCAGCTGCAATCGCATTATTGCAGGTAGTAGCAGCACATGGTCTTGGGGTTTGCTAGCTGGGTATTTCTT
TATGATCCTGTCGTTTAGATAG
AA sequence
>Lus10039907 pacid=23165336 polypeptide=Lus10039907 locus=Lus10039907.g ID=Lus10039907.BGIv1.0 annot-version=v1.0
MDSKFSLFLLLLLALCLPPLWADQSGAIVPRELWCVAKNNAPDSALQSAIDWACGAGGANCSPIQQGGPCYDDSDLQRAASWAFNDYFLKNGMTDDACNF
SDTAALISLNPSRGNCKFPSSPGTSSFSTETTMGMGRSDSADMSSCNRIIAGSSSTWSWGLLAGYFFMILSFR

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G58100 PDCB5 plasmodesmata callose-binding ... Lus10039907 0 1
AT2G28660 Chloroplast-targeted copper ch... Lus10040870 5.6 0.8982
AT1G67590 Remorin family protein (.1.2) Lus10036997 7.2 0.8993
AT1G76160 SKS5 SKU5 similar 5 (.1) Lus10030045 8.9 0.9031
AT4G33400 Vacuolar import/degradation, V... Lus10021729 8.9 0.9227
AT3G27330 zinc finger (C3HC4-type RING f... Lus10022324 11.9 0.9208
AT5G42330 unknown protein Lus10013229 15.1 0.9172
AT3G16490 IQD26 IQ-domain 26 (.1) Lus10043033 15.4 0.9137
AT3G01015 TPX2 (targeting protein for Xk... Lus10030836 16.1 0.9155
AT2G07690 MCM5 MINICHROMOSOME MAINTENANCE 5, ... Lus10019592 16.3 0.9181
AT4G24710 P-loop containing nucleoside t... Lus10019473 17.9 0.9167

Lus10039907 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.