Lus10039923 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G66852 93 / 6e-25 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G16230 97 / 3e-24 O-Glycosyl hydrolases family 17 protein (.1)
AT4G34480 97 / 4e-24 O-Glycosyl hydrolases family 17 protein (.1)
AT1G66855 90 / 6e-24 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G63225 89 / 1e-23 Carbohydrate-binding X8 domain superfamily protein (.1)
AT5G63240 90 / 2e-23 Carbohydrate-binding X8 domain superfamily protein (.1)
AT1G66870 89 / 3e-23 Carbohydrate-binding X8 domain superfamily protein (.1)
AT2G30933 89 / 4e-23 Carbohydrate-binding X8 domain superfamily protein (.1.2)
AT4G09462 88 / 4e-23 Carbohydrate-binding X8 domain superfamily protein (.1)
AT4G09467 85 / 6e-22 Carbohydrate-binding X8 domain superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10012080 116 / 7e-31 AT2G16230 564 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10032719 105 / 2e-27 AT2G16230 430 / 4e-149 O-Glycosyl hydrolases family 17 protein (.1)
Lus10016539 100 / 3e-25 AT5G24318 484 / 1e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10040461 98 / 3e-24 AT2G16230 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10023576 97 / 5e-24 AT2G16230 644 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Lus10040294 97 / 5e-24 AT3G55430 483 / 2e-169 O-Glycosyl hydrolases family 17 protein (.1)
Lus10040808 96 / 1e-23 AT5G24318 484 / 2e-168 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10005459 90 / 6e-22 AT5G24318 341 / 3e-115 O-Glycosyl hydrolases family 17 protein (.1.2)
Lus10001516 89 / 2e-21 AT2G30933 143 / 3e-40 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G153800 110 / 7e-29 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.002G261800 109 / 1e-28 AT2G16230 635 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.008G055900 100 / 3e-25 AT3G55430 494 / 8e-174 O-Glycosyl hydrolases family 17 protein (.1)
Potri.008G056000 100 / 3e-25 AT3G55430 494 / 1e-173 O-Glycosyl hydrolases family 17 protein (.1)
Potri.009G115400 99 / 6e-25 AT4G34480 645 / 0.0 O-Glycosyl hydrolases family 17 protein (.1)
Potri.001G240000 99 / 2e-24 AT5G24318 508 / 2e-178 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.012G017800 93 / 1e-22 AT5G24318 583 / 0.0 O-Glycosyl hydrolases family 17 protein (.1.2)
Potri.001G351600 87 / 1e-22 AT1G78520 119 / 9e-36 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.014G114500 84 / 4e-21 AT1G66870 96 / 1e-26 Carbohydrate-binding X8 domain superfamily protein (.1)
Potri.011G099000 82 / 5e-21 AT1G78520 133 / 4e-42 Carbohydrate-binding X8 domain superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF07983 X8 X8 domain
Representative CDS sequence
>Lus10039923 pacid=23173523 polypeptide=Lus10039923 locus=Lus10039923.g ID=Lus10039923.BGIv1.0 annot-version=v1.0
ATGGCAAAGGTTGGGGAAATGGGATTGTTTGGAAGGTCGTCTCTTTCTGTTTCAAGTTACAGTGAGGCGGAGTACGGGGCGGACATGCTTGCCGCCGTCC
AGGAGGGGGTAGTGCATGGAGTCGTTGATTTTAGCGGGCTCCTTGAGGGCGACGGCCGCGTCGAGGGCCTTGTTGACGGAATTGGCCTTGCGGAGCATGT
GCGACTTGAAATCGAAGATGCACAAGGGAAACGTTCTTGGTGTGTGCCCAAACAAGGAGTGGCAGATGCGCAATTACAAGCAAATCTTGACTATGTATGT
GGACTTCCGGATATGGACTGTAGCCCAATCCAACCAGGAGGCCCATGTTACGAGCCCAACACAGTGGCTTCTCATGCAGCATTTGCCATGAATCTCTTTT
TCCAAAATCATGGTACAAATCATGATTGTGAGTTCTCCGACACAGCCATCGTTACAAACATGGATCCTAGTAGGTCTACTTAA
AA sequence
>Lus10039923 pacid=23173523 polypeptide=Lus10039923 locus=Lus10039923.g ID=Lus10039923.BGIv1.0 annot-version=v1.0
MAKVGEMGLFGRSSLSVSSYSEAEYGADMLAAVQEGVVHGVVDFSGLLEGDGRVEGLVDGIGLAEHVRLEIEDAQGKRSWCVPKQGVADAQLQANLDYVC
GLPDMDCSPIQPGGPCYEPNTVASHAAFAMNLFFQNHGTNHDCEFSDTAIVTNMDPSRST

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G34480 O-Glycosyl hydrolases family 1... Lus10039923 0 1
AT4G11650 ATOSM34 osmotin 34 (.1) Lus10017170 10.3 0.6230
AT2G26820 ATPP2-A3 phloem protein 2-A3 (.1) Lus10026891 16.6 0.6067
AT1G05270 TraB family protein (.1) Lus10038420 20.0 0.4832
AT3G07970 QRT2 QUARTET 2, Pectin lyase-like s... Lus10038344 24.5 0.6009
Lus10019981 28.1 0.5811
AT3G18990 B3 REM39, VRN1 REDUCED VERNALIZATION RESPONSE... Lus10025506 31.7 0.5805
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011981 33.5 0.5675
Lus10028295 35.5 0.5798
Lus10013963 41.7 0.5719
AT1G17020 ATSRG1, SRG1 senescence-related gene 1 (.1) Lus10011980 49.3 0.5645

Lus10039923 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.