Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G15790 91 / 1e-22 CYP40, SQN SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) AT3G63400 72 / 7e-16 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) AT4G38740 65 / 5e-14 ROC1 rotamase CYP 1 (.1) AT2G21130 63 / 3e-13 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G34870 60 / 3e-12 ATCYP1, ROC5 ARABIDOPSIS THALIANA CYCLOPHILIN 1, rotamase cyclophilin 5 (.1) AT4G34960 60 / 7e-12 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT2G16600 58 / 3e-11 ROC3 rotamase CYP 3 (.1.2) AT3G55920 58 / 4e-11 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G32420 56 / 6e-10 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3.4) AT3G56070 54 / 8e-10 ROC2 rotamase cyclophilin 2 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023860 [exp] 98 / 4e-25 AT2G15790 599 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Lus10020992 [exp] 98 / 4e-25 AT2G15790 598 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Lus10027924 [exp] 92 / 6e-23 AT2G15790 534 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Lus10012059 [exp] 92 / 7e-23 AT2G15790 596 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Lus10013111 [exp] 71 / 2e-15 AT3G63400 288 / 5e-85 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10018746 [exp] 70 / 9e-15 AT3G63400 306 / 4e-98 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10024831 [exp] 68 / 3e-14 AT3G63400 308 / 8e-99 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Lus10007579 [exp] 65 / 7e-14 AT2G16600 311 / 2e-110 rotamase CYP 3 (.1.2) Lus10012167 [exp] 65 / 7e-14 AT2G16600 313 / 4e-111 rotamase CYP 3 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G144300 [exp] 96 / 1e-24 AT2G15790 590 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.005G135500 [exp] 95 / 4e-24 AT2G15790 553 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.007G040100 [exp] 93 / 2e-23 AT2G15790 551 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.009G106200 [exp] 92 / 4e-23 AT2G15790 561 / 0.0 SQUINT, CYCLOPHILIN 40, peptidyl-prolyl cis-trans isomerase / cyclophilin-40 (CYP40) / rotamase (.1) Potri.005G215800 [exp] 71 / 2e-15 AT3G63400 252 / 2e-77 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3) Potri.002G021500 [exp] 68 / 4e-15 AT2G16600 278 / 2e-97 rotamase CYP 3 (.1.2) Potri.009G130100 [exp] 66 / 2e-14 AT2G21130 279 / 1e-97 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.004G168800 [exp] 65 / 4e-14 AT2G16600 278 / 4e-97 rotamase CYP 3 (.1.2) Potri.005G240200 [exp] 64 / 9e-14 AT2G16600 276 / 2e-96 rotamase CYP 3 (.1.2) Potri.002G047200 [exp] 66 / 2e-13 AT3G63400 229 / 1e-66 Cyclophilin-like peptidyl-prolyl cis-trans isomerase family protein (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039929 pacid=23173505 polypeptide=Lus10039929 locus=Lus10039929.g ID=Lus10039929.BGIv1.0 annot-version=v1.0 ATGCGGCCAAGGTGTTTCTTAGACATAAGCATCGCCGGTGAGCTTGAAAATGGGGTTGTCTTCGAGCTCTACACAAGCTTGAAAATGGTGGTGTCTAGAA CTGCTGTGAACTTAAGGAATCTCTACACCAGTGAGAAAGGCAATGCCCATACCATCTGTTTCCCTCTTCAGTTTAAGGGAAACGTATTCCATCATGTGAT AAAAGGCTTCATGATAAAAGGGAGAGACATCTCAGCTGGAGACGGGACAATCCCAATGCTCGATATTGCCATTGATGATTGTGGAGAGATCCATGAAGGC GAGGATGATGGAGTAACAAACTTCTTCAAGGATGGGGAGCAATATGCTGATTGGCTAGCTGACAATACCATCTGA
AA sequence Show only first row Show all	>Lus10039929 pacid=23173505 polypeptide=Lus10039929 locus=Lus10039929.g ID=Lus10039929.BGIv1.0 annot-version=v1.0 MRPRCFLDISIAGELENGVVFELYTSLKMVVSRTAVNLRNLYTSEKGNAHTICFPLQFKGNVFHHVIKGFMIKGRDISAGDGTIPMLDIAIDDCGEIHEG EDDGVTNFFKDGEQYADWLADNTI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G15790		CYP40, SQN	SQUINT, CYCLOPHILIN 40, peptid...		Lus10039929 [exp]	0	1

Compare expression of checked genes

Lus10039929 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.