Lus10039933 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G15470 196 / 2e-58 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G54200 182 / 2e-53 Transducin/WD40 repeat-like superfamily protein (.1)
AT1G64610 73 / 5e-15 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT2G37670 70 / 4e-14 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G42010 69 / 1e-13 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G02430 67 / 4e-13 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G24320 67 / 6e-13 Transducin/WD40 repeat-like superfamily protein (.1.2)
AT1G48870 59 / 2e-10 Transducin/WD40 repeat-like superfamily protein (.1)
AT5G53500 59 / 4e-10 Transducin/WD40 repeat-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027670 390 / 7e-141 AT3G15470 196 / 2e-58 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10024399 85 / 4e-19 AT2G37670 850 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10023033 84 / 8e-19 AT5G24320 508 / 3e-171 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10003206 84 / 9e-19 AT1G64610 427 / 1e-141 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10032436 83 / 1e-18 AT5G24320 516 / 1e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10017312 77 / 1e-16 AT1G64610 439 / 4e-146 Transducin/WD40 repeat-like superfamily protein (.1.2)
Lus10020846 66 / 1e-12 AT1G48870 407 / 3e-135 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10023797 66 / 2e-12 AT5G02430 423 / 7e-135 Transducin/WD40 repeat-like superfamily protein (.1)
Lus10003974 65 / 3e-12 AT2G37670 837 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G122500 314 / 4e-102 AT3G15470 835 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.001G403400 314 / 6e-102 AT3G15470 828 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.001G086600 100 / 2e-24 AT5G24320 514 / 1e-173 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.003G144400 87 / 4e-20 AT5G24320 516 / 4e-174 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.002G174100 78 / 6e-17 AT5G53500 523 / 1e-177 Transducin/WD40 repeat-like superfamily protein (.1)
Potri.005G057600 73 / 3e-15 AT5G24320 384 / 3e-124 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.012G018200 70 / 6e-14 AT5G24320 606 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.007G110500 69 / 6e-14 AT5G24320 411 / 1e-134 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.015G009700 69 / 1e-13 AT5G24320 621 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1.2)
Potri.006G084600 67 / 4e-13 AT2G37670 920 / 0.0 Transducin/WD40 repeat-like superfamily protein (.1)
PFAM info
Representative CDS sequence
>Lus10039933 pacid=23173502 polypeptide=Lus10039933 locus=Lus10039933.g ID=Lus10039933.BGIv1.0 annot-version=v1.0
ATGTCATCCTCGGTCACAGCAAATGGGAAATTTGTTGTCTCAGCTAGTGAGGACTCATATGTCTACATATGGAAGCATGAGGCTGATTCACGGTTGACTA
GAAGCAAAGGTGTTACTGTGACTCGATCATATGAGCATTTCCATTGCCAAGATGTATCTGCTGCGATTCCATGGCCTGGAATTGGTGAAACTTGGGGGCT
TGCAGAAAGTCTATGTAGTTTGCAAAATGGTCGAGATGGCCATCTAGATGAAGTCTCCATTGCAAACCATCCACCTACACCTGCAGAGGAAGTTAGTGGG
GGTGATCGTTCCCAATCATTGTCCGGATGCACAGGCAGTCCACTGAATGGAATCATCTCCAGCGCAACAAATGGCTACTTCTTCGACAGAATCTCAGCAA
CATGGCCAGAGGAAAAACTGAATTTAGCCACTAGAAACCGTAGTCCTCAGACGAGTGTGGATGTGACCAATGGGCTGATGAACCAAAATATATCAGCTTA
TGGGATGGTGATTGTCACAGCTGGCCTAAGAGGAGAGATCAGAGCTTACCAAAATTTTGGTTTGCCAGTTCGAATATGA
AA sequence
>Lus10039933 pacid=23173502 polypeptide=Lus10039933 locus=Lus10039933.g ID=Lus10039933.BGIv1.0 annot-version=v1.0
MSSSVTANGKFVVSASEDSYVYIWKHEADSRLTRSKGVTVTRSYEHFHCQDVSAAIPWPGIGETWGLAESLCSLQNGRDGHLDEVSIANHPPTPAEEVSG
GDRSQSLSGCTGSPLNGIISSATNGYFFDRISATWPEEKLNLATRNRSPQTSVDVTNGLMNQNISAYGMVIVTAGLRGEIRAYQNFGLPVRI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G15470 Transducin/WD40 repeat-like su... Lus10039933 0 1
AT3G15470 Transducin/WD40 repeat-like su... Lus10027670 1.0 0.8849
AT5G20680 TBL16 TRICHOME BIREFRINGENCE-LIKE 16... Lus10027651 3.7 0.8381
AT1G60890 Phosphatidylinositol-4-phospha... Lus10020821 9.4 0.7859
AT3G54810 GATA GATA8, BME3, BM... GATA TRANSCRIPTION FACTOR 8, B... Lus10009227 9.5 0.7970
AT1G06230 GTE4 global transcription factor gr... Lus10034067 10.7 0.8176
AT5G06700 TBR TRICHOME BIREFRINGENCE, Plant ... Lus10021066 12.3 0.8218
AT3G54810 GATA GATA8, BME3, BM... GATA TRANSCRIPTION FACTOR 8, B... Lus10037994 12.6 0.8006
AT1G69830 ATAMY3, AMY3 alpha-amylase-like 3 (.1) Lus10013270 12.7 0.8298
AT5G26670 Pectinacetylesterase family pr... Lus10010084 13.9 0.7852
AT5G67470 ATFH6 ARABIDOPSIS FORMIN HOMOLOG 6, ... Lus10011524 14.3 0.8157

Lus10039933 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.