Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62930 180 / 2e-58 SGNH hydrolase-type esterase superfamily protein (.1) AT5G45920 94 / 1e-24 SGNH hydrolase-type esterase superfamily protein (.1) AT3G11210 62 / 1e-12 SGNH hydrolase-type esterase superfamily protein (.1) AT2G38180 58 / 5e-11 SGNH hydrolase-type esterase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027675 [exp] 220 / 2e-74 AT5G62930 414 / 2e-148 SGNH hydrolase-type esterase superfamily protein (.1) Lus10013941 [exp] 103 / 8e-29 AT5G45920 257 / 1e-87 SGNH hydrolase-type esterase superfamily protein (.1) Lus10000525 [exp] 102 / 4e-28 AT5G45920 337 / 4e-118 SGNH hydrolase-type esterase superfamily protein (.1) Lus10028290 [exp] 72 / 4e-16 AT3G11210 402 / 2e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10040197 [exp] 68 / 9e-15 AT3G11210 402 / 5e-143 SGNH hydrolase-type esterase superfamily protein (.1) Lus10004815 [exp] 66 / 7e-14 AT3G11210 323 / 3e-112 SGNH hydrolase-type esterase superfamily protein (.1) Lus10027790 [exp] 59 / 3e-11 AT2G38180 194 / 1e-59 SGNH hydrolase-type esterase superfamily protein (.1) Lus10035506 [exp] 58 / 7e-11 AT3G11210 244 / 7e-79 SGNH hydrolase-type esterase superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G081900 [exp] 176 / 6e-57 AT5G62930 403 / 3e-144 SGNH hydrolase-type esterase superfamily protein (.1) Potri.011G063800 [exp] 104 / 7e-29 AT5G45920 357 / 6e-126 SGNH hydrolase-type esterase superfamily protein (.1) Potri.004G053800 [exp] 103 / 1e-28 AT5G45920 329 / 3e-115 SGNH hydrolase-type esterase superfamily protein (.1) Potri.006G100300 [exp] 71 / 7e-16 AT3G11210 327 / 8e-114 SGNH hydrolase-type esterase superfamily protein (.1) Potri.008G068000 [exp] 70 / 1e-15 AT3G11210 419 / 5e-150 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G116100 [exp] 67 / 1e-14 AT3G11210 337 / 9e-118 SGNH hydrolase-type esterase superfamily protein (.1) Potri.010G189300 [exp] 65 / 9e-14 AT3G11210 414 / 4e-148 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G116000 [exp] 60 / 5e-12 AT3G11210 306 / 1e-105 SGNH hydrolase-type esterase superfamily protein (.1) Potri.016G115800 [exp] 59 / 1e-11 AT3G11210 307 / 4e-106 SGNH hydrolase-type esterase superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0264 [flax] [poplar] SGNH_hydrolase PF00657 [flax] [poplar] Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Representative CDS sequence Show only first row Show all	>Lus10039938 pacid=23173499 polypeptide=Lus10039938 locus=Lus10039938.g ID=Lus10039938.BGIv1.0 annot-version=v1.0 ATGTATGGCGAGAGAGCTATGGAACTGCCTGAGAGGACAAATGAAATGACTGGAGTCTATACATGGCATTGCGTGGAGTTAGCCAAGGAACTGGGAGTGC TCTCCATTAATTTATGGTCCAAAATGCAGGAAACTGAAGGCTGGCAGAAAAAATACCTGAGCGATGGTCTCCACTTGACACCTGAAGGAAATGCAGTGGT GTTCCACGAAGTAACAAAAGTGTTCAGCGAAGCTTGGCTGTCTCCTGCAGAAATACCATTTGATTTCCCTCACCATTCTCATATTGACGGGAAGAACCCG GAAAAAGCTTTCGATCAGCCATTCTTGTAG
AA sequence Show only first row Show all	>Lus10039938 pacid=23173499 polypeptide=Lus10039938 locus=Lus10039938.g ID=Lus10039938.BGIv1.0 annot-version=v1.0 MYGERAMELPERTNEMTGVYTWHCVELAKELGVLSINLWSKMQETEGWQKKYLSDGLHLTPEGNAVVFHEVTKVFSEAWLSPAEIPFDFPHHSHIDGKNP EKAFDQPFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G62930			SGNH hydrolase-type esterase s...		Lus10039938 [exp]	0	1
AT3G57270		BG1	"beta-1,3-glucanase 1", beta-1...		Lus10000843 [exp]	7.5	1.0000
					Lus10001326 [exp]	12.3	1.0000
AT1G18100		MFT, E12A11	MOTHER OF FT AND TFL1, PEBP (p...		Lus10002592 [exp]	13.1	1.0000
					Lus10004351 [exp]	16.9	1.0000
					Lus10022996 [exp]	18.3	1.0000
					Lus10025806 [exp]	18.5	1.0000
AT5G35750		AHK2	histidine kinase 2 (.1)		Lus10009736 [exp]	19.6	1.0000
AT4G13090		XTH2	xyloglucan endotransglucosylas...		Lus10025919 [exp]	22.3	1.0000
					Lus10026755 [exp]	26.2	1.0000
					Lus10033373 [exp]	26.8	1.0000

Compare expression of checked genes

Lus10039938 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.