Lus10039942 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G34320 44 / 1e-05 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011601 50 / 2e-08 AT2G13980 46 / 3e-07 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Lus10025056 44 / 3e-06 ND /
Lus10022194 42 / 8e-05 AT3G21540 76 / 8e-15 transducin family protein / WD-40 repeat family protein (.1)
Lus10032660 39 / 0.001 AT4G21760 525 / 6e-175 beta-glucosidase 47 (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039942 pacid=23173408 polypeptide=Lus10039942 locus=Lus10039942.g ID=Lus10039942.BGIv1.0 annot-version=v1.0
ATGGCGGGAGAGAAATCAAAGGGTATGGCGGCATTGCTCGTCAACCGCTATATGGGTATGGAGACCATTAAGGAGTGGCAAGCAGTGCGCCAATTAGTCG
GATTGAGCACAACTCTAACCATCCCAACGATTATTCGATGTTTGAAATGGCACCCTCCTCTGCCACCTCCGCTAAAGTGTAATGTGGATGCCGGTTTCTG
GCCATTGGAACATCGTTGGGGTTGTGGCATGATCTTAAGAGATCATGGAGGTTCATTCATTGCTTGTGGAGCGTTCCATTCGACGGGAACCCCTAAGGTT
CGCGAAGGTGAAACCCTAGCATTGCTTGAGCCCATGAATTGGGCAGCTCGTTACGATCATTTAGATGTTGGCGATAATGAGTATAACTCGGGGTGGTATA
GAGTTCAGCCATATTATTGCTTCTTCCATGGATTTTTTGCTTGCTTGGCTCTCGTTTCGCATGGTTAG
AA sequence
>Lus10039942 pacid=23173408 polypeptide=Lus10039942 locus=Lus10039942.g ID=Lus10039942.BGIv1.0 annot-version=v1.0
MAGEKSKGMAALLVNRYMGMETIKEWQAVRQLVGLSTTLTIPTIIRCLKWHPPLPPPLKCNVDAGFWPLEHRWGCGMILRDHGGSFIACGAFHSTGTPKV
REGETLALLEPMNWAARYDHLDVGDNEYNSGWYRVQPYYCFFHGFFACLALVSHG

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G34320 Polynucleotidyl transferase, r... Lus10039942 0 1
Lus10007927 2.8 1.0000
Lus10023587 4.0 1.0000
AT1G74670 GASA6 GA-stimulated Arabidopsis 6, G... Lus10024216 4.9 1.0000
AT2G25470 AtRLP21 receptor like protein 21 (.1) Lus10027855 6.0 1.0000
AT3G19540 Protein of unknown function (D... Lus10028040 6.3 1.0000
AT3G20800 Cell differentiation, Rcd1-lik... Lus10031542 7.3 1.0000
AT1G48120 hydrolases;protein serine/thre... Lus10015869 7.9 1.0000
AT1G28030 2-oxoglutarate (2OG) and Fe(II... Lus10012760 8.2 0.9815
AT4G12570 UPL5 ubiquitin protein ligase 5 (.1... Lus10039026 8.5 1.0000
AT1G17930 Aminotransferase-like, plant m... Lus10016922 8.5 1.0000

Lus10039942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.