Lus10039945 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40390 165 / 4e-47 RS5, SIP1 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
AT4G01970 81 / 2e-17 RS4, ATSTS raffinose synthase 4, stachyose synthase (.1)
AT5G20250 76 / 5e-16 RS6, DIN10 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
AT3G57520 71 / 5e-14 RS2, ATSIP2 raffinose synthase 2, seed imbibition 2 (.1.2.3)
AT1G55740 66 / 2e-12 RS1, ATSIP1 raffinose synthase 1, seed imbibition 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027679 295 / 1e-95 AT5G40390 1040 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10022240 181 / 1e-54 AT5G40390 744 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10041370 129 / 9e-38 AT5G40390 71 / 8e-15 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10017516 85 / 6e-19 AT5G20250 1145 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Lus10007537 70 / 7e-14 AT3G57520 1235 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Lus10008771 0 / 1 AT5G40390 339 / 1e-112 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T124908 215 / 2e-65 AT5G40390 1055 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.007G123400 198 / 4e-59 AT5G40390 1147 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.017G036700 192 / 4e-57 AT5G40390 1118 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.004G207900 180 / 1e-52 AT5G40390 1145 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.002G193700 94 / 3e-22 AT4G01970 1040 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.014G118400 92 / 1e-21 AT4G01970 1087 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.015G086400 84 / 1e-18 AT3G57520 827 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Potri.011G166700 69 / 2e-13 AT1G55740 1154 / 0.0 raffinose synthase 1, seed imbibition 1 (.1)
Potri.006G065700 68 / 3e-13 AT5G20250 1154 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Potri.018G126400 66 / 2e-12 AT5G20250 1218 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF05691 Raffinose_syn Raffinose synthase or seed imbibition protein Sip1
Representative CDS sequence
>Lus10039945 pacid=23173425 polypeptide=Lus10039945 locus=Lus10039945.g ID=Lus10039945.BGIv1.0 annot-version=v1.0
ATGGATCCATCCTGCGCTGCCACTATTATGCTCTCCCAACCAGAGACTGTCTCTTCCAAGATCCCTTGCACGATGGCAAAACTATGCTCAAGATTTGGAA
CATCAACAAGGAGGAGGTGGTGTCCTCAATCTAGGAGAAAGACGAGTGCTTCCCGATTCTCCCACTCCATTTCTTGCACAGCTAGTCCAAAGGACATTGA
ATGGTACAGCGGGAAGACCCCAATTTCCACCAAAGGACTTACCGTGTTTGCTGTCTATATGTGCAACGCTAAGAAACTTAAGCTGTTGAAATTTGGCGAC
AGCTGGGAACTTTCCCTACCACCCTTTGATTTCGAACTGCTCACTGTTTCCCCGGTGAAACTCGTGCCGGGGATTTCAGTGCAGTTTGCACCCATCGGAT
TGACGAACATGCTCAACTCCGGAGGTGAGATTCAGTTCGTTGAGATGGACGATGACGGACAGAGCTTGATGCGCGTTGGAGTGAAGGGATGTGGAGAAAT
GAAGGCTTTTGCTTCGGAAAAGCCATCAAGTTGTTGGATGGACGGGAAGGAAGTTGAGTTTCAGTATGATGATCAGATGGTCACTATTGAAGTCCCTTGG
CCAGGATCTGGTATGTCGACTGAAATAGAATACAGATTTTGA
AA sequence
>Lus10039945 pacid=23173425 polypeptide=Lus10039945 locus=Lus10039945.g ID=Lus10039945.BGIv1.0 annot-version=v1.0
MDPSCAATIMLSQPETVSSKIPCTMAKLCSRFGTSTRRRWCPQSRRKTSASRFSHSISCTASPKDIEWYSGKTPISTKGLTVFAVYMCNAKKLKLLKFGD
SWELSLPPFDFELLTVSPVKLVPGISVQFAPIGLTNMLNSGGEIQFVEMDDDGQSLMRVGVKGCGEMKAFASEKPSSCWMDGKEVEFQYDDQMVTIEVPW
PGSGMSTEIEYRF

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10039945 0 1
Lus10008841 1.4 0.8756
Lus10017698 2.2 0.8796
AT5G64300 ATGCH, ATRIBA1,... RED FLUORESCENT IN DARKNESS 1,... Lus10006669 6.0 0.8458
AT4G25650 TIC55-IV, PTC52... TRANSLOCON AT THE INNER ENVELO... Lus10013916 6.7 0.8370
AT1G52820 2-oxoglutarate (2OG) and Fe(II... Lus10013130 7.5 0.8381
Lus10002344 11.8 0.7966
AT4G35500 Protein kinase superfamily pro... Lus10035984 12.0 0.8079
AT5G44265 Bifunctional inhibitor/lipid-t... Lus10033667 12.5 0.7576
AT2G43870 Pectin lyase-like superfamily ... Lus10011417 13.6 0.7942
Lus10039432 14.4 0.7942

Lus10039945 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.