Lus10039946 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G40390 123 / 4e-33 RS5, SIP1 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
AT4G01970 101 / 2e-25 RS4, ATSTS raffinose synthase 4, stachyose synthase (.1)
AT5G20250 90 / 3e-21 RS6, DIN10 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
AT3G57520 80 / 7e-18 RS2, ATSIP2 raffinose synthase 2, seed imbibition 2 (.1.2.3)
AT1G55740 77 / 6e-17 RS1, ATSIP1 raffinose synthase 1, seed imbibition 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027679 187 / 1e-55 AT5G40390 1040 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10022241 129 / 4e-37 AT5G40390 342 / 2e-112 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Lus10017516 94 / 2e-22 AT5G20250 1145 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Lus10007537 76 / 2e-16 AT3G57520 1235 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.T124908 140 / 9e-39 AT5G40390 1055 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.017G036700 133 / 2e-36 AT5G40390 1118 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.004G207900 132 / 6e-36 AT5G40390 1145 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.007G123400 131 / 6e-36 AT5G40390 1147 / 0.0 seed imbibition 1-like, raffinose synthase 5, Raffinose synthase family protein (.1)
Potri.002G193700 103 / 5e-26 AT4G01970 1040 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.014G118400 103 / 6e-26 AT4G01970 1087 / 0.0 raffinose synthase 4, stachyose synthase (.1)
Potri.018G126400 89 / 8e-21 AT5G20250 1218 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Potri.006G065700 88 / 1e-20 AT5G20250 1154 / 0.0 raffinose synthase 6, DARK INDUCIBLE 10, Raffinose synthase family protein (.1.2.3.4)
Potri.015G086400 82 / 1e-18 AT3G57520 827 / 0.0 raffinose synthase 2, seed imbibition 2 (.1.2.3)
Potri.011G166700 82 / 2e-18 AT1G55740 1154 / 0.0 raffinose synthase 1, seed imbibition 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0058 Glyco_hydro_tim PF05691 Raffinose_syn Raffinose synthase or seed imbibition protein Sip1
Representative CDS sequence
>Lus10039946 pacid=23173501 polypeptide=Lus10039946 locus=Lus10039946.g ID=Lus10039946.BGIv1.0 annot-version=v1.0
ATGAACCTCACGGCTTCTCGGTGCACTATGATGGAGAAGCTGCTCCTCAAGAAGTTTTCAGGCTATGCCCAGCTCCCGCACTCTACGGTGTGGATCCCTA
CGGTTCCTCAAGTAGTCACAAACTGGGCCTCCCTCCAACCCTCCGCCGATCACAACGACTACGTGGACATGTGCGTGGAAAGTGGGTCGACCAGGGTCAC
CGGATCGATCTTCGGGAGCTGCCTGTATATGCAGGCAGGGGATGACCCGTATACTCTGTTGAAGGACTCAGTGAAGGCTATTAAGGTACATTTAGCGACG
TTCAATCTGTTGGAAGAAAAATCCCCGCCTGATATTGTGGACAAATTAGGATGGTGCACTTGGGACGCATTTTACCTCAACGTAAACCCTAAGGGAGTGA
AGGGAAGGAGTGAAGGGACTGGTGGAAGGCGGGTGCCCAGCGGGTATGGTGCTGATCGACGACGGGTGGCAGTCAATTTTTCACGACGACGATCCAATTA
TAGACCGTGA
AA sequence
>Lus10039946 pacid=23173501 polypeptide=Lus10039946 locus=Lus10039946.g ID=Lus10039946.BGIv1.0 annot-version=v1.0
MNLTASRCTMMEKLLLKKFSGYAQLPHSTVWIPTVPQVVTNWASLQPSADHNDYVDMCVESGSTRVTGSIFGSCLYMQAGDDPYTLLKDSVKAIKVHLAT
FNLLEEKSPPDIVDKLGWCTWDAFYLNVNPKGVKGRSEGTGGRRVPSGYGADRRRVAVNFSRRRSNYRP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G40390 RS5, SIP1 seed imbibition 1-like, raffin... Lus10039946 0 1
Lus10011286 1.7 0.7399
AT5G67240 SDN3 small RNA degrading nuclease 3... Lus10019320 4.2 0.7061
AT2G20900 DGK5, ATDGK5 diacylglycerol kinase 5 (.1.2.... Lus10039747 15.9 0.7392
AT5G14345 AtENODL21 early nodulin-like protein 21 ... Lus10032111 18.4 0.7385
AT3G62390 TBL6 TRICHOME BIREFRINGENCE-LIKE 6 ... Lus10017671 21.0 0.6978
Lus10007507 27.3 0.7299
AT2G32360 Ubiquitin-like superfamily pro... Lus10015125 30.9 0.7187
AT2G44840 AP2_ERF ATERF13, EREBP ethylene-responsive element bi... Lus10029332 33.9 0.6426
AT3G01490 Protein kinase superfamily pro... Lus10030621 37.8 0.5964
AT2G36780 UDP-Glycosyltransferase superf... Lus10023894 39.2 0.6782

Lus10039946 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.