Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18530 66 / 2e-15 EF hand calcium-binding protein family (.1) AT3G25600 65 / 5e-15 Calcium-binding EF-hand family protein (.1) AT2G41110 39 / 5e-05 ACAM-2, ATCAL5, CAM2 calmodulin 2 (.1.2) AT2G27030 38 / 6e-05 CAM5, CAM2, ACAM-2, ACAM-5 calmodulin 5 (.1.2.3) AT3G43810 38 / 7e-05 CAM7 calmodulin 7 (.1) AT5G37780 39 / 8e-05 ACAM-1, TCH1, CAM1 TOUCH 1, calmodulin 1 (.1.2.3) AT5G21274 38 / 8e-05 ACAM-6, CAM6 calmodulin 6 (.1) AT3G56800 38 / 8e-05 ACAM-3, CAM3 calmodulin 3 (.1) AT1G66410 38 / 9e-05 ACAM-4, CAM4 calmodulin 4 (.1.2) AT1G32250 37 / 0.0002 Calcium-binding EF-hand family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027243 [exp] 81 / 3e-21 AT1G18530 208 / 5e-70 EF hand calcium-binding protein family (.1) Lus10017900 [exp] 65 / 8e-15 AT3G25600 252 / 4e-87 Calcium-binding EF-hand family protein (.1) Lus10038953 [exp] 60 / 4e-13 AT1G18530 115 / 2e-07 EF hand calcium-binding protein family (.1) Lus10030986 [exp] 41 / 8e-06 AT1G32250 219 / 3e-74 Calcium-binding EF-hand family protein (.1) Lus10022589 [exp] 39 / 5e-05 AT3G43810 255 / 2e-88 calmodulin 7 (.1) Lus10021487 [exp] 39 / 6e-05 AT2G41110 255 / 1e-88 calmodulin 2 (.1.2) Lus10041288 [exp] 38 / 9e-05 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10037423 [exp] 38 / 9e-05 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3) Lus10038981 [exp] 38 / 9e-05 AT2G27030 300 / 2e-106 calmodulin 5 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G132800 [exp] 67 / 7e-16 AT3G25600 229 / 4e-78 Calcium-binding EF-hand family protein (.1) Potri.015G052600 [exp] 65 / 5e-15 AT1G18530 213 / 8e-72 EF hand calcium-binding protein family (.1) Potri.001G138000 [exp] 41 / 6e-06 AT3G03000 221 / 8e-75 EF hand calcium-binding protein family (.1) Potri.003G095700 [exp] 41 / 6e-06 AT3G03000 220 / 1e-74 EF hand calcium-binding protein family (.1) Potri.006G026700 [exp] 38 / 7e-05 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.009G021500 [exp] 38 / 7e-05 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.016G024700 [exp] 38 / 7e-05 AT3G43810 300 / 2e-106 calmodulin 7 (.1) Potri.001G222200 [exp] 38 / 0.0001 AT2G27030 304 / 6e-107 calmodulin 5 (.1.2.3) Potri.014G070700 [exp] 37 / 0.0003 AT1G18210 94 / 2e-24 Calcium-binding EF-hand family protein (.1.2) Potri.008G159300 [exp] 35 / 0.0007 AT3G22930 235 / 1e-80 calmodulin-like 11 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039961 pacid=23173454 polypeptide=Lus10039961 locus=Lus10039961.g ID=Lus10039961.BGIv1.0 annot-version=v1.0 ATGGACTCGAACGGAAAGGGATTTGTCAAATTAGAGGAGCTTCTAGTGGCGAACGCCCACAAAATCGACGAGCAGACGCTGGTCAACCAGGAGCACTTGC TAGAGAACTTTCGGTTGTTTGACCGAGACGAGAACGACATGAGAACGTCAGCAGAGCTCAGTAGCGCGATGGAGAAGATGGGGCAGCTACCAACGAAGAC GACGACGGGATGA
AA sequence Show only first row Show all	>Lus10039961 pacid=23173454 polypeptide=Lus10039961 locus=Lus10039961.g ID=Lus10039961.BGIv1.0 annot-version=v1.0 MDSNGKGFVKLEELLVANAHKIDEQTLVNQEHLLENFRLFDRDENDMRTSAELSSAMEKMGQLPTKTTTG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G18530			EF hand calcium-binding protei...		Lus10039961 [exp]	0	1
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10020251 [exp]	6.9	0.7936
AT3G12690		AGC1.5	AGC kinase 1.5 (.1.2.3)		Lus10001757 [exp]	7.1	0.8077
AT4G38960	CO		B-box type zinc finger family ...		Lus10035472 [exp]	7.1	0.8306
AT1G11310		PMR2, ATMLO2, M...	POWDERY MILDEW RESISTANT 2, MI...		Lus10011630 [exp]	15.0	0.8584
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10028914 [exp]	15.0	0.8089
AT4G21340	bHLH	bHLH103, B70	basic helix-loop-helix (bHLH) ...		Lus10005959 [exp]	22.4	0.8275
AT5G10530			Concanavalin A-like lectin pro...		Lus10029555 [exp]	29.3	0.8275
AT1G56580		SVB	SMALLER WITH VARIABLE BRANCHES...		Lus10000354 [exp]	37.5	0.8031
AT1G22340		ATUGT85A7	UDP-glucosyl transferase 85A7 ...		Lus10000992 [exp]	45.0	0.7488
AT4G33820			Glycosyl hydrolase superfamily...		Lus10014647 [exp]	45.3	0.7639

Compare expression of checked genes

Lus10039961 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.