Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G38850 50 / 1e-09 SAUR-AC1, ATSAUR15, ATSR15AU, SAUR15, SAUR_AC1 SMALL AUXIN UP RNA 1 FROM ARABIDOPSIS THALIANA ECOTYPE COLUMBIA, ARABIDOPSIS COLUMBIA SAUR GENE 1, ARABIDOPSIS THALIANA SMALL AUXIN UPREGULATED 15, SAUR-like auxin-responsive protein family (.1) AT5G18080 50 / 2e-09 SAUR24 small auxin up RNA 24, SAUR-like auxin-responsive protein family (.1) AT5G18020 49 / 3e-09 SAUR-like auxin-responsive protein family (.1) AT5G18050 49 / 5e-09 SAUR-like auxin-responsive protein family (.1) AT4G38825 49 / 5e-09 SAUR-like auxin-responsive protein family (.1) AT4G13790 47 / 3e-08 SAUR-like auxin-responsive protein family (.1) AT4G38820 45 / 2e-07 unknown protein AT2G21200 45 / 2e-07 SAUR-like auxin-responsive protein family (.1) AT4G31320 46 / 4e-07 SAUR-like auxin-responsive protein family (.1) AT3G51200 43 / 1e-06 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10027690 [exp] 174 / 1e-58 AT5G18020 52 / 2e-10 SAUR-like auxin-responsive protein family (.1) Lus10033348 [exp] 49 / 5e-08 AT2G24400 155 / 3e-48 SAUR-like auxin-responsive protein family (.1) Lus10007561 [exp] 45 / 4e-07 AT4G34810 125 / 1e-38 SAUR-like auxin-responsive protein family (.1) Lus10042378 [exp] 44 / 9e-07 AT4G34810 129 / 3e-40 SAUR-like auxin-responsive protein family (.1) Lus10026294 [exp] 44 / 1e-06 AT4G34810 124 / 3e-38 SAUR-like auxin-responsive protein family (.1) Lus10021341 [exp] 43 / 2e-06 AT2G36210 123 / 4e-37 SAUR-like auxin-responsive protein family (.1) Lus10017018 [exp] 43 / 2e-06 AT2G36210 124 / 3e-37 SAUR-like auxin-responsive protein family (.1) Lus10012184 [exp] 43 / 2e-06 AT4G34810 125 / 9e-39 SAUR-like auxin-responsive protein family (.1) Lus10027317 [exp] 42 / 4e-06 AT5G18030 119 / 1e-36 SAUR-like auxin-responsive protein family (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G054600 [exp] 72 / 1e-17 AT4G31320 58 / 1e-11 SAUR-like auxin-responsive protein family (.1) Potri.004G165450 [exp] 47 / 5e-08 AT4G38840 129 / 2e-40 SAUR-like auxin-responsive protein family (.1) Potri.004G164700 [exp] 46 / 6e-08 AT5G18020 122 / 8e-38 SAUR-like auxin-responsive protein family (.1) Potri.004G165300 [exp] 46 / 7e-08 AT4G38840 130 / 6e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G126900 [exp] 45 / 1e-07 AT4G38840 131 / 1e-41 SAUR-like auxin-responsive protein family (.1) Potri.009G127300 [exp] 45 / 2e-07 AT2G21210 104 / 8e-31 SAUR-like auxin-responsive protein family (.1) Potri.006G211000 [exp] 44 / 9e-07 AT2G36210 130 / 3e-40 SAUR-like auxin-responsive protein family (.1) Potri.008G003900 [exp] 42 / 3e-06 AT2G24400 110 / 1e-31 SAUR-like auxin-responsive protein family (.1) Potri.001G060400 [exp] 43 / 4e-06 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1) Potri.006G070600 [exp] 42 / 5e-06 AT5G18060 61 / 6e-13 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [flax] [poplar] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Lus10039962 pacid=23173517 polypeptide=Lus10039962 locus=Lus10039962.g ID=Lus10039962.BGIv1.0 annot-version=v1.0 ATGGAGATCAGGCTAGTGATGTCTGTGCTTCAGAAGTGGTGCGGAGTCAAACTGCGGCGGAAGACGGAAGGGAGTAGCTGGAGGAGAGGATACATTGGGA TGTACGTCGGAAAAGATGGGGAAAGGTATGAAGTTCCGGTGAAGTGGCTGGGGAATCCGGCGGTGCAGGAGTTGATGAGGCGATCGGAGGATAACGTGGC GCTTCTAGATTACAAGATAGTAGGGCCCATGTCTCTTTCCTGCTCCGTCGATACATTCCACCGTGTGTTGTTCGACGTCCGTTAG
AA sequence Show only first row Show all	>Lus10039962 pacid=23173517 polypeptide=Lus10039962 locus=Lus10039962.g ID=Lus10039962.BGIv1.0 annot-version=v1.0 MEIRLVMSVLQKWCGVKLRRKTEGSSWRRGYIGMYVGKDGERYEVPVKWLGNPAVQELMRRSEDNVALLDYKIVGPMSLSCSVDTFHRVLFDVR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G18080		SAUR24	small auxin up RNA 24, SAUR-li...		Lus10039962 [exp]	0	1
AT1G77860		KOM	KOMPEITO, Rhomboid-related int...		Lus10028036 [exp]	13.4	0.8171
AT2G41660		MIZ1	mizu-kussei 1, Protein of unkn...		Lus10035443 [exp]	21.7	0.7618
AT3G07870			F-box and associated interacti...		Lus10012357 [exp]	27.1	0.7745
AT1G68460		ATIPT1	Arabidopsis thaliana isopenten...		Lus10034332 [exp]	53.3	0.7530
AT5G05340			Peroxidase superfamily protein...		Lus10006535 [exp]	99.8	0.7729
AT3G07200			RING/U-box superfamily protein...		Lus10040641 [exp]	109.8	0.7431
					Lus10041974 [exp]	114.7	0.7381
AT3G26040			HXXXD-type acyl-transferase fa...		Lus10005361 [exp]	157.0	0.7177
AT5G03310			SAUR-like auxin-responsive pro...		Lus10037990 [exp]	157.0	0.7410
AT1G76510	ARID		ARID/BRIGHT DNA-binding domain...		Lus10026569 [exp]	160.1	0.7077

Compare expression of checked genes

Lus10039962 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.