Lus10039963 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G63000 269 / 1e-92 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10027691 377 / 3e-134 AT5G63000 260 / 3e-88 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G078600 265 / 3e-91 AT5G63000 291 / 3e-101 Mitochondrial import inner membrane translocase subunit Tim17/Tim22/Tim23 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF02466 Tim17 Tim17/Tim22/Tim23/Pmp24 family
Representative CDS sequence
>Lus10039963 pacid=23173450 polypeptide=Lus10039963 locus=Lus10039963.g ID=Lus10039963.BGIv1.0 annot-version=v1.0
ATGGATCCCACGGAAGAGGCAGAAAACGCTGTGCCAGAGGGGTCTAAAAAATTAGCGGGGACTGTTAGTTGGAGCTCAGCTACCCTTATCGGATTTTTCA
CAGGCATGATATATGGTGCTTCTAAGGAGGCCTCTGCATCCGCTAGTATAGATGCAGATGTAATGCTGAAGCTAGGAAGCACACCGAACAAGATGAAGCA
GTATAACTTGATGAGAGATGCAATGGAGAGACGATTTCTCAAGGTAAGTCGTGGAGCTTTGGTTGGTGGGGTGCGACTCAGCATGTTTACTGCTGCATTT
TGTGGTCTGCAAAACTTGATGGCTGAGCAACGGGGTGTGCACGATGTTTTCAATGTCGTTGGAGCCGGTTCAGTCACTGCTGCTGCGTTTGGTCTAATCT
TGCCTGGATCTCTTCGGTGGCGTGCTAGGAATGTGCTACTTGGATCAACTCTCGGCGCAGCAGTGTGTTTTCCCCTAGGTTGGATCCAGATGAAGTTGGT
GGAGAAGGCAAATGAAGGGAACGTGACTGGTGATCGTAGTTCCTCCAACACAAAGGGTGGTGTGGGAGCTGCAATTGAGAGGCTTGAAGCAAAAGTGAAG
AGAGACCAAGATACATGA
AA sequence
>Lus10039963 pacid=23173450 polypeptide=Lus10039963 locus=Lus10039963.g ID=Lus10039963.BGIv1.0 annot-version=v1.0
MDPTEEAENAVPEGSKKLAGTVSWSSATLIGFFTGMIYGASKEASASASIDADVMLKLGSTPNKMKQYNLMRDAMERRFLKVSRGALVGGVRLSMFTAAF
CGLQNLMAEQRGVHDVFNVVGAGSVTAAAFGLILPGSLRWRARNVLLGSTLGAAVCFPLGWIQMKLVEKANEGNVTGDRSSSNTKGGVGAAIERLEAKVK
RDQDT

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G63000 Mitochondrial import inner mem... Lus10039963 0 1
AT3G51980 ARM repeat superfamily protein... Lus10038535 4.6 0.8315
AT4G09800 RPS18C S18 ribosomal protein (.1) Lus10022057 12.9 0.8755
AT4G14320 Zinc-binding ribosomal protein... Lus10038130 17.9 0.8668
AT5G23535 KOW domain-containing protein ... Lus10022069 18.5 0.8614
AT2G20450 Ribosomal protein L14 (.1) Lus10008246 22.3 0.8511
AT1G07770 RPS15A ribosomal protein S15A (.1.2) Lus10043001 24.7 0.8564
AT5G50810 TIM8 translocase inner membrane sub... Lus10022450 26.2 0.8492
AT1G74270 Ribosomal protein L35Ae family... Lus10027754 32.1 0.8514
AT1G22780 RPS18A, PFL1, P... 40S RIBOSOMAL PROTEIN S18, POI... Lus10042603 38.3 0.8509
AT2G44820 unknown protein Lus10036053 41.6 0.8406

Lus10039963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.