Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10003766 [exp] 121 / 4e-37 ND 36 / 0.004 Lus10039338 [exp] 116 / 7e-36 ND / Lus10032975 [exp] 92 / 1e-25 ND 40 / 1e-04 Lus10037411 [exp] 79 / 8e-19 AT2G28450 874 / 0.0 zinc finger (CCCH-type) family protein (.1), zinc finger (CCCH-type) family protein (.2) Lus10006779 [exp] 69 / 9e-17 AT5G63920 42 / 2e-05 topoisomerase 3alpha (.1) Lus10005485 [exp] 58 / 1e-12 ND 34 / 0.007 Lus10024526 [exp] 41 / 2e-05 AT2G40070 66 / 2e-11 unknown protein Lus10015856 [exp] 36 / 0.0006 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [flax] [poplar] Zn_Beta_Ribbon PF06839 [flax] [poplar] zf-GRF GRF zinc finger
Representative CDS sequence Show only first row Show all	>Lus10039973 pacid=23173510 polypeptide=Lus10039973 locus=Lus10039973.g ID=Lus10039973.BGIv1.0 annot-version=v1.0 ATGGGATCGAGTTCAATTACGTGTTCCCACAACGTAGAGGCCGTTCTGAAGACGGTGGCTACTGCAAAGGATCGTGGCCAGACCTTCTTGCGATACATGT TCAGGACGACTTCCGATTGCGGGTTCTTCGCATGGGAGTCCGATTGTTCCCGATTTGAATTGGAGGCTGCAATTCCTGACCAAGGCATCACAAGGAGGCT TGAAGAACCAATGGCGAGCTTGCAGTTCGATCTGGTTTGA
AA sequence Show only first row Show all	>Lus10039973 pacid=23173510 polypeptide=Lus10039973 locus=Lus10039973.g ID=Lus10039973.BGIv1.0 annot-version=v1.0 MGSSSITCSHNVEAVLKTVATAKDRGQTFLRYMFRTTSDCGFFAWESDCSRFELEAAIPDQGITRRLEEPMASLQFDLV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10039973 [exp]	0	1
					Lus10024734 [exp]	1.0	0.9807
					Lus10020988 [exp]	3.9	0.8160
					Lus10003695 [exp]	5.7	0.8937
AT5G47670	CCAAT	NF-YB6, L1L	"nuclear factor Y, subunit B6"...		Lus10008978 [exp]	6.9	0.8937
AT3G55700			UDP-Glycosyltransferase superf...		Lus10040724 [exp]	8.0	0.8937
AT5G16910		ATCSLD2	cellulose-synthase like D2 (.1...		Lus10012119 [exp]	8.5	0.6521
					Lus10020958 [exp]	8.9	0.8937
					Lus10021906 [exp]	9.8	0.8937
AT4G35700	C2H2ZnF	DAZ3	DUO1-activated zinc finger 3, ...		Lus10041633 [exp]	10.6	0.8937
AT4G35260		IDH-I, IDH1	isocitrate dehydrogenase I, is...		Lus10014436 [exp]	11.3	0.8937

Compare expression of checked genes

Lus10039973 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.