Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G18760 103 / 5e-27 AtRLP51 receptor like protein 51 (.1) AT5G45770 99 / 4e-25 AtRLP55 receptor like protein 55 (.1) AT5G65710 56 / 6e-10 HSL2 HAESA-like 2 (.1) AT1G35710 53 / 9e-09 Protein kinase family protein with leucine-rich repeat domain (.1) AT3G11010 52 / 1e-08 AtRLP34 receptor like protein 34 (.1) AT1G08590 51 / 3e-08 Leucine-rich receptor-like protein kinase family protein (.1) AT3G11080 50 / 6e-08 AtRLP35 receptor like protein 35 (.1) AT4G36180 49 / 2e-07 Leucine-rich receptor-like protein kinase family protein (.1) AT1G28440 49 / 3e-07 HSL1 HAESA-like 1 (.1) AT1G13230 48 / 3e-07 Leucine-rich repeat (LRR) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10015226 [exp] 158 / 2e-47 AT4G18760 401 / 2e-137 receptor like protein 51 (.1) Lus10007294 [exp] 133 / 6e-38 AT4G18760 391 / 1e-133 receptor like protein 51 (.1) Lus10005430 [exp] 109 / 2e-30 AT4G18760 293 / 3e-98 receptor like protein 51 (.1) Lus10031377 [exp] 55 / 2e-09 AT3G20820 433 / 3e-152 Leucine-rich repeat (LRR) family protein (.1) Lus10009429 [exp] 53 / 7e-09 AT1G34420 809 / 0.0 leucine-rich repeat transmembrane protein kinase family protein (.1) Lus10033924 [exp] 53 / 8e-09 AT1G75640 1332 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10042177 [exp] 52 / 2e-08 AT4G36180 1253 / 0.0 Leucine-rich receptor-like protein kinase family protein (.1) Lus10014243 [exp] 51 / 3e-08 AT4G28650 268 / 3e-83 Leucine-rich repeat transmembrane protein kinase family protein (.1) Lus10038686 [exp] 51 / 3e-08 AT3G47570 752 / 0.0 Leucine-rich repeat protein kinase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G069500 [exp] 116 / 1e-31 AT4G18760 375 / 4e-127 receptor like protein 51 (.1) Potri.004G059500 [exp] 112 / 3e-30 AT4G18760 375 / 7e-127 receptor like protein 51 (.1) Potri.017G016600 [exp] 58 / 1e-10 AT1G28440 1130 / 0.0 HAESA-like 1 (.1) Potri.017G028600 [exp] 57 / 3e-10 AT3G59510 372 / 8e-127 Leucine-rich repeat (LRR) family protein (.1) Potri.004G049100 [exp] 56 / 5e-10 AT1G28440 1387 / 0.0 HAESA-like 1 (.1) Potri.017G028400 [exp] 56 / 7e-10 AT3G59510 366 / 6e-124 Leucine-rich repeat (LRR) family protein (.1) Potri.012G028366 [exp] 55 / 1e-09 AT1G45616 316 / 5e-93 receptor like protein 6 (.1) Potri.002G256500 [exp] 54 / 3e-09 AT4G28650 1339 / 0.0 Leucine-rich repeat transmembrane protein kinase family protein (.1) Potri.012G009200 [exp] 54 / 3e-09 AT1G45616 386 / 7e-118 receptor like protein 6 (.1) Potri.013G037500 [exp] 54 / 4e-09 AT4G08850 551 / 0.0 Leucine-rich repeat receptor-like protein kinase family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0022 [flax] [poplar] LRR PF00560 [flax] [poplar] LRR_1 Leucine Rich Repeat
Representative CDS sequence Show only first row Show all	>Lus10039985 pacid=23173410 polypeptide=Lus10039985 locus=Lus10039985.g ID=Lus10039985.BGIv1.0 annot-version=v1.0 ATGGGTGTCTTTCTCTCCCGTTTCACCAACCTCACCACTCTCTCAGTAGTCGACTCCCCAATTGCCACCTCCAGGATCTATGTCGTCATCGGAAACATGC ACAAGCTCACTTCTTTAAAAATCTCCAACGCCAATCTCTTTGACGCCATCCCCAAAGACCTCGCAAACAACAACAACCTCACCTTCGTCAATTTCTCCTG TAATAGCCTCAAGGGAAGGATTCCAAGCTCCATTGTTGTACTGGAGAATCTTCAAGCTCTCAATCTTTCATCCAATTGGCTCTCTAGCGAGCTCCCGACC AACTTCGACGACCTAATCTCACTGAAGAATGTATCTCTAGCATTGAATTCGTTGTTCGGCTCGATTCCAGATTCGATGGCCTTGATCTACGAGCTGTAG
AA sequence Show only first row Show all	>Lus10039985 pacid=23173410 polypeptide=Lus10039985 locus=Lus10039985.g ID=Lus10039985.BGIv1.0 annot-version=v1.0 MGVFLSRFTNLTTLSVVDSPIATSRIYVVIGNMHKLTSLKISNANLFDAIPKDLANNNNLTFVNFSCNSLKGRIPSSIVVLENLQALNLSSNWLSSELPT NFDDLISLKNVSLALNSLFGSIPDSMALIYEL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45770		AtRLP55	receptor like protein 55 (.1)		Lus10039985 [exp]	0	1
AT3G21400			unknown protein		Lus10006520 [exp]	3.9	0.8361
AT5G07590			Transducin/WD40 repeat-like su...		Lus10042992 [exp]	6.7	0.8045
AT4G21610		LOL2	lsd one like 2 (.1)		Lus10020766 [exp]	6.9	0.7851
AT4G18760		AtRLP51	receptor like protein 51 (.1)		Lus10005430 [exp]	12.4	0.8137
AT5G16390		CAC1-A, BCCP-1,...	BIOTIN CARBOXYL-CARRIER PROTEI...		Lus10020619 [exp]	12.9	0.8196
AT3G48590	CCAAT	NF-YC1, ATHAP5A...	"nuclear factor Y, subunit C1"...		Lus10022444 [exp]	20.3	0.8110
AT5G01090			Concanavalin A-like lectin fam...		Lus10021117 [exp]	21.7	0.7991
AT4G16650			O-fucosyltransferase family pr...		Lus10028957 [exp]	26.9	0.7145
AT5G01020			Protein kinase superfamily pro...		Lus10036762 [exp]	31.6	0.7738
AT4G22130		SRF8	STRUBBELIG-receptor family 8 (...		Lus10020030 [exp]	34.2	0.7459

Compare expression of checked genes

Lus10039985 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.