Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47810 89 / 4e-23 PFK2 phosphofructokinase 2 (.1) AT4G32840 57 / 1e-11 PFK6 phosphofructokinase 6 (.1) AT5G61580 57 / 1e-11 PFK4 phosphofructokinase 4 (.1.2) AT4G29220 56 / 3e-11 PFK1 phosphofructokinase 1 (.1) AT4G26270 53 / 4e-10 PFK3 phosphofructokinase 3 (.1) AT5G56630 52 / 9e-10 PFK7 phosphofructokinase 7 (.1) AT2G22480 46 / 1e-07 PFK5 phosphofructokinase 5 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10008812 [exp] 107 / 1e-29 AT5G47810 697 / 0.0 phosphofructokinase 2 (.1) Lus10005488 [exp] 61 / 8e-13 AT4G32840 765 / 0.0 phosphofructokinase 6 (.1) Lus10006032 [exp] 61 / 9e-13 AT4G26270 742 / 0.0 phosphofructokinase 3 (.1) Lus10035001 [exp] 53 / 4e-10 AT4G26270 812 / 0.0 phosphofructokinase 3 (.1) Lus10011143 [exp] 52 / 1e-09 AT4G26270 837 / 0.0 phosphofructokinase 3 (.1) Lus10043044 [exp] 52 / 1e-09 AT4G26270 840 / 0.0 phosphofructokinase 3 (.1) Lus10012738 [exp] 42 / 3e-06 AT2G22480 869 / 0.0 phosphofructokinase 5 (.1) Lus10002648 [exp] 42 / 3e-06 AT2G22480 868 / 0.0 phosphofructokinase 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.016G002700 [exp] 90 / 3e-23 AT5G47810 643 / 0.0 phosphofructokinase 2 (.1) Potri.006G235066 [exp] 63 / 6e-14 AT4G26270 331 / 7e-113 phosphofructokinase 3 (.1) Potri.003G151100 [exp] 58 / 7e-12 AT5G61580 797 / 0.0 phosphofructokinase 4 (.1.2) Potri.006G152600 [exp] 53 / 4e-10 AT4G26270 827 / 0.0 phosphofructokinase 3 (.1) Potri.018G069200 [exp] 51 / 1e-09 AT4G26270 808 / 0.0 phosphofructokinase 3 (.1) Potri.007G010300 [exp] 41 / 6e-06 AT2G22480 816 / 0.0 phosphofructokinase 5 (.1) Potri.001G079501 [exp] 41 / 7e-06 AT5G61580 235 / 2e-75 phosphofructokinase 4 (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10039992 pacid=23173433 polypeptide=Lus10039992 locus=Lus10039992.g ID=Lus10039992.BGIv1.0 annot-version=v1.0 ATGGCCGGTTATACCGGGTTCGTGACAGGCCCCGTGAATGGCGTCTATGCATACATACCGTTGGAGGAAGTTGCAGTAGCTAAAAATGAGGCGGATGTGA ATGATCATAAGTGGGTATGGGTTAGATCAGTCACCAACCAGCCTGATTTCATTAAAGAGGATGCATAA
AA sequence Show only first row Show all	>Lus10039992 pacid=23173433 polypeptide=Lus10039992 locus=Lus10039992.g ID=Lus10039992.BGIv1.0 annot-version=v1.0 MAGYTGFVTGPVNGVYAYIPLEEVAVAKNEADVNDHKWVWVRSVTNQPDFIKEDA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G47810		PFK2	phosphofructokinase 2 (.1)		Lus10039992 [exp]	0	1
					Lus10011339 [exp]	5.2	0.8526
AT3G07720			Galactose oxidase/kelch repeat...		Lus10012345 [exp]	6.0	0.8271
					Lus10003135 [exp]	12.8	0.8270
AT5G56460			Protein kinase superfamily pro...		Lus10013406 [exp]	13.0	0.8222
AT1G47410			unknown protein		Lus10006481 [exp]	13.9	0.8477
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Lus10010880 [exp]	14.3	0.8127
AT4G15130		ATCCT2	phosphorylcholine cytidylyltra...		Lus10000195 [exp]	21.4	0.7905
AT2G32300		UCC1	uclacyanin 1 (.1)		Lus10003799 [exp]	21.8	0.7887
AT1G65660		SMP1	SWELLMAP 1, Pre-mRNA splicing ...		Lus10007479 [exp]	27.8	0.7776
AT3G28030		UVR1, UVH3	UV REPAIR DEFECTIVE 1, ULTRAVI...		Lus10039482 [exp]	29.8	0.7164

Compare expression of checked genes

Lus10039992 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.