Lus10039994 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10001472 78 / 2e-19 ND /
Lus10002600 52 / 7e-09 AT3G14770 62 / 1e-10 Nodulin MtN3 family protein (.1)
Lus10032779 38 / 0.0003 ND /
Lus10004094 36 / 0.0006 ND /
Lus10012943 0 / 1 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10039994 pacid=23173406 polypeptide=Lus10039994 locus=Lus10039994.g ID=Lus10039994.BGIv1.0 annot-version=v1.0
ATGGTGAAGTGGATGATTCGTCCTCCTAGTAAGGATCCAATTGATTTTCATGGAGCTTCCACCATGAGGTACACCATTGAAATGCATTACAATGGTGTCC
TAGACCCCCACCGGTATGTGTACGGTTCAGTAGTGCATTTTGACAGAGTCGATGACCGAAATCAACAAAATGATCGAGCTACTAATGATCGATTGGAAGT
ACTTCCAAATATTGTACTCTGCACTAGGGAAGGAATACATGACGGCTTGAGACCGTTAGAAGGAGAAGCTGATATTGTTGCTTTCAATCTTACCGCTGCT
GAGGCTTTGTCTGAGGAAGTTAACTGA
AA sequence
>Lus10039994 pacid=23173406 polypeptide=Lus10039994 locus=Lus10039994.g ID=Lus10039994.BGIv1.0 annot-version=v1.0
MVKWMIRPPSKDPIDFHGASTMRYTIEMHYNGVLDPHRYVYGSVVHFDRVDDRNQQNDRATNDRLEVLPNIVLCTREGIHDGLRPLEGEADIVAFNLTAA
EALSEEVN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10039994 0 1
Lus10034884 1.7 0.8409
AT5G06060 NAD(P)-binding Rossmann-fold s... Lus10040731 2.8 0.8024
AT3G23610 DSPTP1 dual specificity protein phosp... Lus10021940 7.7 0.8012
Lus10032581 7.7 0.7908
Lus10003883 10.6 0.7844
Lus10034297 11.8 0.7908
AT1G47270 TUB AtTLP6 tubby like protein 6 (.1.2) Lus10010645 12.6 0.7951
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10026597 21.5 0.7488
AT5G36930 Disease resistance protein (TI... Lus10011240 23.7 0.7183
Lus10011351 25.7 0.7425

Lus10039994 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.