Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20370 47 / 6e-08 AtMUR3, MUR3, KAM1 MURUS 3, KATAMARI 1, Exostosin family protein (.1) AT4G13990 43 / 2e-06 Exostosin family protein (.1) AT2G29040 41 / 1e-05 Exostosin family protein (.1) AT2G31990 38 / 9e-05 Exostosin family protein (.1) AT5G62220 37 / 0.0002 ATGT18 glycosyltransferase 18 (.1) AT2G32750 36 / 0.0004 Exostosin family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005492 [exp] 91 / 9e-26 AT4G13990 64 / 2e-13 Exostosin family protein (.1) Lus10016532 [exp] 86 / 1e-21 AT2G29040 546 / 0.0 Exostosin family protein (.1) Lus10004967 [exp] 57 / 2e-11 AT2G29040 573 / 0.0 Exostosin family protein (.1) Lus10001578 [exp] 57 / 2e-11 AT2G29040 566 / 0.0 Exostosin family protein (.1) Lus10006694 [exp] 51 / 4e-09 AT4G13990 617 / 0.0 Exostosin family protein (.1) Lus10003440 [exp] 49 / 7e-09 AT2G29040 204 / 3e-63 Exostosin family protein (.1) Lus10022862 [exp] 49 / 1e-08 AT2G20370 951 / 0.0 MURUS 3, KATAMARI 1, Exostosin family protein (.1) Lus10024961 [exp] 49 / 1e-08 AT2G20370 959 / 0.0 MURUS 3, KATAMARI 1, Exostosin family protein (.1) Lus10001028 [exp] 47 / 6e-08 AT4G13990 499 / 1e-173 Exostosin family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G147800 [exp] 57 / 2e-11 AT4G13990 534 / 0.0 Exostosin family protein (.1) Potri.001G321000 [exp] 55 / 1e-10 AT4G13990 660 / 0.0 Exostosin family protein (.1) Potri.009G032500 [exp] 54 / 2e-10 AT2G29040 588 / 0.0 Exostosin family protein (.1) Potri.002G256200 [exp] 54 / 4e-10 AT2G20370 964 / 0.0 MURUS 3, KATAMARI 1, Exostosin family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040003 pacid=23173516 polypeptide=Lus10040003 locus=Lus10040003.g ID=Lus10040003.BGIv1.0 annot-version=v1.0 ATGAGGGACGATCTGATTCCGCTGATTTCGACGGTGGTGTATGCTGATTCGCGGTCGATATTGGAGGCGTTGGAGGACGCGTTTGATTGGCCGATGAGTG GGGTTTTGGAGAGGGTTGAAAGGGCTAGGAAGGCGATAGAGACAGGGAGGAATTTGACGGTAACGTCGAAGAAGAAAGAGGAAAGTAACTAG
AA sequence Show only first row Show all	>Lus10040003 pacid=23173516 polypeptide=Lus10040003 locus=Lus10040003.g ID=Lus10040003.BGIv1.0 annot-version=v1.0 MRDDLIPLISTVVYADSRSILEALEDAFDWPMSGVLERVERARKAIETGRNLTVTSKKKEESN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20370		AtMUR3, MUR3, K...	MURUS 3, KATAMARI 1, Exostosin...		Lus10040003 [exp]	0	1
AT5G46795		MSP2	microspore-specific promoter ...		Lus10004566 [exp]	6.7	1.0000
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10001280 [exp]	7.1	1.0000
AT1G12570			Glucose-methanol-choline (GMC)...		Lus10002957 [exp]	10.0	1.0000
AT3G07740		HXA2, HXA02, HA...	homolog of yeast ADA2 2A (.1.2...		Lus10012337 [exp]	11.6	1.0000
AT3G20760			Nse4, component of Smc5/6 DNA ...		Lus10004185 [exp]	12.2	1.0000
					Lus10010778 [exp]	12.4	1.0000
AT4G01830		ABCB5, PGP5	ATP-binding cassette B5, P-gly...		Lus10004529 [exp]	15.6	1.0000
					Lus10010609 [exp]	16.7	1.0000
					Lus10009800 [exp]	17.3	1.0000
AT3G18990	B3	REM39, VRN1	REDUCED VERNALIZATION RESPONSE...		Lus10010756 [exp]	19.0	1.0000

Compare expression of checked genes

Lus10040003 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.