Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G13840 100 / 2e-26 FZR3 FIZZY-related 3 (.1.2) AT4G11920 92 / 7e-24 FZR1, CCS52A2 FIZZY-RELATED 1, cell cycle switch protein 52 A2 (.1) AT4G22910 91 / 1e-23 CCS52A1, FZR2 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) AT4G33270 70 / 6e-16 AtCDC20.1, CDC20.1 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) AT4G33260 69 / 1e-15 AtCDC20.2, CDC20.2 cell division cycle 20.2, Transducin family protein / WD-40 repeat family protein (.1.2) AT5G27570 65 / 4e-14 AtCDC20.5 cell division cycle 20.5, Transducin/WD40 repeat-like superfamily protein (.1) AT5G27945 64 / 4e-14 Transducin/WD40 repeat-like superfamily protein (.1) AT5G27080 64 / 8e-14 AtCDC20.3 cell division cycle 20.3, Transducin family protein / WD-40 repeat family protein (.1) AT5G26900 63 / 1e-13 AtCDC20.4 cell division cycle 20.4, Transducin family protein / WD-40 repeat family protein (.1) AT5G52820 41 / 1e-05 WD-40 repeat family protein / notchless protein, putative (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023401 [exp] 110 / 1e-30 AT5G13840 546 / 0.0 FIZZY-related 3 (.1.2) Lus10040282 [exp] 111 / 2e-30 AT5G13840 685 / 0.0 FIZZY-related 3 (.1.2) Lus10001192 [exp] 91 / 3e-23 AT4G22910 734 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Lus10024482 [exp] 91 / 3e-23 AT4G22910 733 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Lus10037595 [exp] 69 / 3e-16 AT4G33270 402 / 2e-141 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10037593 [exp] 69 / 1e-15 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006853 [exp] 67 / 7e-15 AT4G33270 729 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10006851 [exp] 67 / 9e-15 AT4G33270 728 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Lus10038263 [exp] 62 / 2e-14 AT4G33270 108 / 1e-29 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G057500 [exp] 106 / 4e-29 AT5G13840 705 / 0.0 FIZZY-related 3 (.1.2) Potri.010G202100 [exp] 106 / 6e-29 AT5G13840 707 / 0.0 FIZZY-related 3 (.1.2) Potri.003G119500 [exp] 91 / 2e-23 AT4G22910 702 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.001G112700 [exp] 88 / 2e-22 AT4G22910 705 / 0.0 cell cycle switch protein 52 A1, FIZZY-related 2 (.1) Potri.016G118400 [exp] 72 / 7e-17 AT4G33270 771 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.019G021800 [exp] 71 / 2e-16 AT4G33270 767 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.013G048900 [exp] 71 / 2e-16 AT4G33270 766 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.016G068700 [exp] 65 / 3e-14 AT4G33270 607 / 0.0 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.015G110300 [exp] 62 / 5e-13 AT4G33270 363 / 5e-122 cell division cycle 20.1, Transducin family protein / WD-40 repeat family protein (.1) Potri.009G058000 [exp] 44 / 1e-06 AT5G52820 811 / 0.0 WD-40 repeat family protein / notchless protein, putative (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0186 [flax] [poplar] Beta_propeller PF00400 [flax] [poplar] WD40 WD domain, G-beta repeat
Representative CDS sequence Show only first row Show all	>Lus10040004 pacid=23173562 polypeptide=Lus10040004 locus=Lus10040004.g ID=Lus10040004.BGIv1.0 annot-version=v1.0 ATGGTGTGGAAGTATCCGTCTTTATCAAAGGTTGCAACTCTAACTGGACACAGTTTGCTGGTTCTCTCCCTTGCCATGTTGCCTGACGGCCAGACCATAG TGACTGGAGCGGGAGATGAAACTCTGCGGTTCTGGAATGTCTTCCCATCCATGAAAACACCTGCGCCGGTTCAAGGGCACTTTTTGTGA
AA sequence Show only first row Show all	>Lus10040004 pacid=23173562 polypeptide=Lus10040004 locus=Lus10040004.g ID=Lus10040004.BGIv1.0 annot-version=v1.0 MVWKYPSLSKVATLTGHSLLVLSLAMLPDGQTIVTGAGDETLRFWNVFPSMKTPAPVQGHFL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G13840		FZR3	FIZZY-related 3 (.1.2)		Lus10040004 [exp]	0	1

Compare expression of checked genes

Lus10040004 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.