Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46490 62 / 3e-13 unknown protein AT5G35110 50 / 7e-09 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019579 [exp] 172 / 2e-56 AT2G46490 73 / 1e-17 unknown protein Lus10000078 [exp] 45 / 1e-06 AT5G35110 49 / 1e-08 unknown protein Lus10006299 [exp] 45 / 1e-06 AT5G35110 49 / 1e-08 unknown protein Lus10006300 [exp] 45 / 1e-06 AT5G35110 49 / 1e-08 unknown protein Lus10000088 [exp] 44 / 2e-06 AT2G46490 49 / 2e-08 unknown protein Lus10006298 [exp] 44 / 2e-06 AT2G46490 49 / 2e-08 unknown protein Lus10003182 [exp] 41 / 1e-05 AT2G46490 49 / 7e-09 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.018G113700 [exp] 55 / 9e-11 AT5G35110 78 / 1e-19 unknown protein Potri.006G189600 [exp] 53 / 8e-10 AT5G35110 71 / 9e-17 unknown protein Potri.018G113901 [exp] 44 / 6e-06 AT5G35110 58 / 1e-10 unknown protein Potri.006G189700 [exp] 38 / 0.0002 AT5G35110 50 / 5e-09 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040009 pacid=23173476 polypeptide=Lus10040009 locus=Lus10040009.g ID=Lus10040009.BGIv1.0 annot-version=v1.0 ATGCCTGGTGGATCCGTGGCCGCCGACGGATTCTTCCGCAACTGGGCGTTTGATAGCGCGTTATCGGGGATTGACCACGGGATCGAGCACCGCCCTTACC ACCGCAACTGTAAATGTGCTCTCCACGACAAGTCCCGTCGCGATGGCGGCAACAACTTCGGCAGATCTTGCGGCGGAAACTGCAGGAACAACGCCGTCTC GTACAAGATCCGTCGATCGTGGAGCGAAGGATCCCTAGCGTTGGCCGCGGCGGCTAACGGATCTGGATCGGGAGTCGGATCATCTCCTTCGTGTTCAACT AACCCTTCCCCTAACCCGGCGGCGGTTCTCGCTCGGAGTATGAGCCGGGATGAACTCTCGTCAGCGGGAAACGATTGA
AA sequence Show only first row Show all	>Lus10040009 pacid=23173476 polypeptide=Lus10040009 locus=Lus10040009.g ID=Lus10040009.BGIv1.0 annot-version=v1.0 MPGGSVAADGFFRNWAFDSALSGIDHGIEHRPYHRNCKCALHDKSRRDGGNNFGRSCGGNCRNNAVSYKIRRSWSEGSLALAAAANGSGSGVGSSPSCST NPSPNPAAVLARSMSRDELSSAGND

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G46490			unknown protein		Lus10040009 [exp]	0	1
AT5G67150			HXXXD-type acyl-transferase fa...		Lus10041591 [exp]	4.9	0.7787
AT2G06050		AtOPR3, DDE1, O...	DELAYED DEHISCENCE 1, oxophyto...		Lus10028663 [exp]	5.5	0.7637
AT3G51380		IQD20	IQ-domain 20 (.1)		Lus10041844 [exp]	8.5	0.7433
AT1G60190		AtPUB19	plant U-box 19, ARM repeat sup...		Lus10029163 [exp]	11.0	0.7023
AT3G06330			RING/U-box superfamily protein...		Lus10012793 [exp]	12.1	0.6777
AT4G17720			RNA-binding (RRM/RBD/RNP motif...		Lus10030952 [exp]	14.5	0.6952
AT3G22970			Protein of unknown function (D...		Lus10003087 [exp]	14.9	0.7698
AT1G18740			Protein of unknown function (D...		Lus10029782 [exp]	28.4	0.7083
AT2G30395	OFP	ATOFP17, OFP17	ovate family protein 17 (.1)		Lus10024191 [exp]	46.0	0.6992
AT3G22970			Protein of unknown function (D...		Lus10014718 [exp]	54.1	0.6879

Compare expression of checked genes

Lus10040009 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.