Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G47380 81 / 2e-22 Cytochrome c oxidase subunit Vc family protein (.1) AT5G61310 77 / 5e-21 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) AT5G40382 65 / 4e-16 Cytochrome c oxidase subunit Vc family protein (.1) AT3G62400 41 / 2e-06 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10002429 [exp] 91 / 4e-26 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10010008 [exp] 91 / 4e-26 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10001454 [exp] 91 / 4e-26 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10025028 [exp] 89 / 2e-25 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Lus10022249 [exp] 66 / 2e-16 AT5G40382 91 / 3e-26 Cytochrome c oxidase subunit Vc family protein (.1) Lus10008765 [exp] 60 / 6e-14 AT5G40382 92 / 6e-27 Cytochrome c oxidase subunit Vc family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G120500 [exp] 82 / 5e-23 AT5G61310 103 / 3e-31 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4) Potri.002G195901 [exp] 82 / 8e-23 AT5G61310 94 / 2e-27 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence Show only first row Show all	>Lus10040012 pacid=23173519 polypeptide=Lus10040012 locus=Lus10040012.g ID=Lus10040012.BGIv1.0 annot-version=v1.0 ATGGCAGGCAGAATTCCTCACGCAACGTTGAAAGGACCGAGTGTGATGAAAGAGATAGTGATAGGGATAGCACTTGGCTTGGTAGCTGGTGGTGCTTGGA AGATGCATCACTGGAATGAGCAGAGGAAGGTCAGGTCATTCTATGACATGCTTGAGAAAGGTGAAATCAGTGTCATTGCTGCAGAATAG
AA sequence Show only first row Show all	>Lus10040012 pacid=23173519 polypeptide=Lus10040012 locus=Lus10040012.g ID=Lus10040012.BGIv1.0 annot-version=v1.0 MAGRIPHATLKGPSVMKEIVIGIALGLVAGGAWKMHHWNEQRKVRSFYDMLEKGEISVIAAE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G61310			Cytochrome c oxidase subunit V...		Lus10040012 [exp]	0	1
AT4G38370			Phosphoglycerate mutase family...		Lus10023935 [exp]	2.0	0.7789
AT1G21550			Calcium-binding EF-hand family...		Lus10042761 [exp]	4.0	0.7466
AT2G38280		ATAMPD, FAC1	EMBRYONIC FACTOR1, ADENOSINE 5...		Lus10005043 [exp]	4.7	0.7652
AT4G26055			unknown protein		Lus10011865 [exp]	6.2	0.6874
AT5G09920		NRPB4, ATRPB15....	RNA polymerase II, Rpb4, core ...		Lus10005796 [exp]	7.3	0.7635
AT2G37120			S1FA-like DNA-binding protein ...		Lus10015073 [exp]	8.1	0.7390
AT1G61700			RNA polymerases N / 8 kDa subu...		Lus10038195 [exp]	12.8	0.7070
AT1G07210			Ribosomal protein S18 (.1)		Lus10039100 [exp]	14.5	0.6684
AT3G15395			unknown protein		Lus10039067 [exp]	15.0	0.7074
					Lus10030382 [exp]	16.1	0.7121

Compare expression of checked genes

Lus10040012 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.