Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G58040 50 / 5e-09 FIP1[V], ATFIP1[V], FIP1[V], ATFIP1[V], FIP1[V], ATFIP1[V], FIP1[V], ATFIPS5, ATFIP1[V], FIP1[V], A homolog of yeast FIP1 [V], homolog of yeast FIP1 [V], homolog of yeast FIP1 [V] (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019609 [exp] 111 / 4e-31 AT5G58040 206 / 2e-58 homolog of yeast FIP1 [V], homolog of yeast FIP1 [V], homolog of yeast FIP1 [V] (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G187400 [exp] 72 / 7e-17 AT5G58040 355 / 1e-102 homolog of yeast FIP1 [V], homolog of yeast FIP1 [V], homolog of yeast FIP1 [V] (.1) Potri.018G110100 [exp] 72 / 8e-17 AT5G58040 355 / 1e-102 homolog of yeast FIP1 [V], homolog of yeast FIP1 [V], homolog of yeast FIP1 [V] (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040031 pacid=23173509 polypeptide=Lus10040031 locus=Lus10040031.g ID=Lus10040031.BGIv1.0 annot-version=v1.0 ATGGAGAAGTTGAAGAAACGGAGTGAGAGGTTCAAGCTTCCTTTGGCTATGGAAAAAGATGGTTCGGGAACAAAGAAGACAGATACTGAGGCATTGCCTC CAGTTAGTAAAATCGAGCCTGCAGCAGATGCAGAGATCAAACCTGAGCGGCCTGCTCGTAGAAGAAGGTGGGTAGGGAACTAG
AA sequence Show only first row Show all	>Lus10040031 pacid=23173509 polypeptide=Lus10040031 locus=Lus10040031.g ID=Lus10040031.BGIv1.0 annot-version=v1.0 MEKLKKRSERFKLPLAMEKDGSGTKKTDTEALPPVSKIEPAADAEIKPERPARRRRWVGN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G58040		FIP1[V], ATFIP1...	homolog of yeast FIP1 [V], hom...		Lus10040031 [exp]	0	1
AT1G59077			unknown protein		Lus10022089 [exp]	3.2	0.8785
AT1G59453			B-block binding subunit of TFI...		Lus10000370 [exp]	6.0	0.8718
AT4G27450			Aluminium induced protein with...		Lus10033418 [exp]	6.9	0.8992
AT4G21510			F-box family protein (.1)		Lus10011255 [exp]	7.5	0.8837
AT5G61830			NAD(P)-binding Rossmann-fold s...		Lus10032525 [exp]	11.6	0.8873
AT3G53500		RSZ32, RS2Z32, ...	arginine/serine-rich zinc knuc...		Lus10009067 [exp]	13.5	0.8758
AT1G01720	NAC	ATAF1, ANAC002	Arabidopsis NAC domain contain...		Lus10018142 [exp]	14.9	0.8902
AT1G10430		PP2A-2	protein phosphatase 2A-2 (.1)		Lus10030810 [exp]	17.5	0.8943
AT5G59310		LTP4	lipid transfer protein 4 (.1)		Lus10039270 [exp]	23.1	0.8295
AT4G00720		ASKTHETA, ATSK3...	SHAGGY-LIKE PROTEIN KINASE THE...		Lus10018850 [exp]	26.7	0.8768

Compare expression of checked genes

Lus10040031 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.