Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019586 [exp] 171 / 2e-56 ND / Lus10006254 [exp] 170 / 1e-55 ND / Lus10013091 [exp] 167 / 2e-55 ND / Lus10010383 [exp] 160 / 5e-53 ND / Lus10005846 [exp] 158 / 3e-51 ND / Lus10038712 [exp] 155 / 8e-51 ND / Lus10031074 [exp] 158 / 1e-50 ND / Lus10025361 [exp] 162 / 3e-49 AT2G14740 454 / 2e-155 VACUOLAR SORTING RECEPTOR 3, VACUOLAR SORTING RECEPTOR 2;2, binding protein of 80 kDa 2;2, vaculolar sorting receptor 3 (.1.2) Lus10022968 [exp] 166 / 5e-49 AT1G10790 214 / 8e-63 unknown protein
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10040033 pacid=23173486 polypeptide=Lus10040033 locus=Lus10040033.g ID=Lus10040033.BGIv1.0 annot-version=v1.0 ATGGTTCAGACCATTTGTGATAGAGGTGGCCCCGCTGTACGGGCCTTGACTTCACTGGTTCGGTCCCAGCACAGCACAGATTCAGACGGAGTAAAGCAGC CGAAGAAGTCGGACGCGCCAAAAGGGAGGCCCTGTGCGCGAAAGACCGATAGGCGGCACCCTTCGTATCACGAGCATGCGAGTGCCCATTGCACCCCACC TAAGGGCAACACCAAATCAGGTACCGGAACTGCGCAACCGGCTAAGCCAACCACAAGCAAGTCTAAAACTTCAATTCCTAACAGAGGTGTGTAG
AA sequence Show only first row Show all	>Lus10040033 pacid=23173486 polypeptide=Lus10040033 locus=Lus10040033.g ID=Lus10040033.BGIv1.0 annot-version=v1.0 MVQTICDRGGPAVRALTSLVRSQHSTDSDGVKQPKKSDAPKGRPCARKTDRRHPSYHEHASAHCTPPKGNTKSGTGTAQPAKPTTSKSKTSIPNRGV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10040033 [exp]	0	1
					Lus10005843 [exp]	3.3	0.9466
					Lus10022511 [exp]	4.7	0.9466
AT2G36690			2-oxoglutarate (2OG) and Fe(II...		Lus10024231 [exp]	5.7	0.9466
AT5G17490	GRAS	AtRGL3, RGL3	RGA-like protein 3 (.1)		Lus10002424 [exp]	6.6	0.9466
AT1G01580		FRD1, ATFRO2, F...	FERRIC CHELATE REDUCTASE DEFEC...		Lus10036381 [exp]	7.4	0.9466
					Lus10010827 [exp]	8.1	0.9466
AT2G01260			Protein of unknown function (D...		Lus10041982 [exp]	8.1	0.6659
					Lus10039269 [exp]	8.3	0.7371
AT1G15550		ATGA3OX1, GA4	GA REQUIRING 4, ARABIDOPSIS TH...		Lus10013135 [exp]	8.8	0.9466
AT4G21390		B120	S-locus lectin protein kinase ...		Lus10032836 [exp]	9.4	0.9466

Compare expression of checked genes

Lus10040033 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.